Os05t0513800-02

Locus

Os05g0513800

Description

Similar to Rac-like GTP-binding protein 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC2

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 2

Oryzabase Gene Symbol Synonym(s)

OsRAC2, OsRac2

Oryzabase Gene Name Synonym(s)

Rac-like GTP-binding protein 2, Rac/Rop-type GTPase 2

Transcript Evidence

AK063536 (DDBJ, Best hit)

Protein Evidence

Q68Y52 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-117-B11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0513800-02)

RiceXPro (AK063536)

Others

Oryzabase (6766)

KEGG (Os05t0513800-02)

Transcript

1950 bp

>Os05t0513800-02 Similar to Rac-like GTP-binding protein 2.
AACACAACAGGTACAAAACTGCAAACAATGGATTCAATCGATTAGTTCTTTGTCATAGTT
TGAAGAGTTCCTTGCTATATATATACTGTAGCAATTCAAGTTGGACAGACTGTTGCTTTA
ATGAACCATTTATGTTGAGCTGATAATGTTGTTGGCCATGGTAGAACATCAAGGCCGTGT
TTGATACTGCCATCAAGGTGGTCCTTCAGCCTCCTCGGAGAAGGGGGGAGACGACGATGG
CAAGGAAGAAGACAAGGCGAAGCACCGGCTGCTCGTTAAAGTAAGAGCACACCTCAAAAG
CCTTAGAATTACATGGTTGGATCTTGTGAGTTGTGATCATGGACTAGCTATTATAATGTT
TGTGCCTAGTAAACATGAGTGCGCATCATTTTCTACTTTGTGAATGAAATAGTATGAATT
ATGCAATGGCTGATGTAACTGTTTTTTTTTTTTTTACTGCAGGAACTTGATGTGTGGCAG
TGCATGTGTTGTTTAGGACCTGTCTGAATTCTTGAAGGTGTGTAAGCGTTGTGTAATGGC
AAGTGAATTTGCTGACTGTTCTGCTGCTTCCATTTACTACTACTAAGCTCTTTCGTGTGT
TTGAATTACTACATCTAGAACTAGAGCATCAGGCTCATAGACTGACTTCATATCAGGTGT
TTGTATCATTAATATTATTATGTAAGAAGGTTGTGGTTTGTGGAACAACTAAATACAACA
ATGCAGGCTATGTTGTAGTATGCTCTGCTACTGGTGTATGTTATAAATATAAAATTCTGC
TACATACTTTTGTGCATCGAGTCGCCTTTTCTTCTTGTTTCTTGCACAATGGCAGATATC
ATTTTTTTGGTCAGTTTAAAAACGAGAAACGCTTATAACCTTTTTCAAAACAAGGCCAGA
AACTATGATTGAGATTATAATGACATCGTTTGACACACCACAGTGCCCACAAGGCTGTTC
AAACTACGAGCTGTTTATTCTGTATTTCTGGCAACACTAATGAAACCAGAGAAAACGCTT
CTGGATTTCTGCATCAGCTATGCGATGAAACCCTTTGAAATCAGAGCACCTGCTTCATTT
TGTAAACATGCTTTTGAGCTTCTCGTTGGCGGATACCAGTTCGGCAGCAACACCAACCTC
GTTAGCGGAGTGTCCTGCATCTGGAACCATCTGTATACGGTAGAAGAGATTAATTATTGA
CTCAATCAAGTACGCATGAACAATATTGCAGTCGGCAGTAAGCACATTCTATCTACACAG
AAATCATTCGAAATGCATTTTATCTAGCGAAGTCAGTAGATCAGGGTATATAAATTTAAG
GTATACGGTAATTTGCCAAAATAACCGTTGCTCATTGCCAAAAACAATGAGCAGGCAACC
TAAATGAGCAGATTACTGTACTCCTATTTGACACAGTTATTTTGGCAATCATTTACATGA
AAAGAATCATTTACCTTAAATTCTGCTTCAGGCCATGCTTTATGAAGATCCCAGGCAGAC
ATCATAGGACAGCAAACATCATACCGGCCCTGCAACATAAAAACACCGATCACTATCAGG
TACTACAATAGTATCATCTCACCTGTATAACTCTTTGCACAAAACTTACAAAATACTCCA
CTTTACAGTAGGAGTAGTAGCTATAAAAAGCATCAAGGCCTAATTTGCCAGTCGAGGGAA
CAATTATGAATAATGCCACTTTACAGTTCCATTGTCATTATGCATTGCATTACAGCACAC
AAAATCCATGTCTTCTTGGCATCCTACATCTACATGCTAGATCAAACATTTGGACACGAC
AATCAACATCAAATCAGAGGAGCTACAGCTAATCTCCAACATGAGAATTCGATCATGTTT
GCTAcaatctattatattattaaaacagctttgaaagaaggcaccacgttcgctggaggc
tagaaattctcacattaatcagagaaaaag

CDS

120 bp

>Os05t0513800-02 Similar to Rac-like GTP-binding protein 2.
AACATCAAGGCCGTGTTTGATACTGCCATCAAGGTGGTCCTTCAGCCTCCTCGGAGAAGG
GGGGAGACGACGATGGCAAGGAAGAAGACAAGGCGAAGCACCGGCTGCTCGTTAAAGTAA

Protein

40 aa

>Os05t0513800-02 Similar to Rac-like GTP-binding protein 2.
NIKAVFDTAIKVVLQPPRRRGETTMARKKTRRSTGCSLK*

5'UTR

chr05:25476232..25476395 (+ strand) : 164 bp

CDS

chr05:25476396..25476515 (+ strand) : 120 bp

3'UTR

chr05:25476516..25478181 (+ strand) : 1666 bp

FASTA

>Os05t0513800-02 class=Sequence position=chr05:25476232..25478181 (+ strand)
AACACAACAG GTACAAAACT GCAAACAATG GATTCAATCG ATTAGTTCTT TGTCATAGTT TGAAGAGTTC CTTGCTATAT
ATATACTGTA GCAATTCAAG TTGGACAGAC TGTTGCTTTA ATGAACCATT TATGTTGAGC TGATAATGTT GTTGGCCATG
GTAGAACATC AAGGCCGTGT TTGATACTGC CATCAAGGTG GTCCTTCAGC CTCCTCGGAG AAGGGGGGAG ACGACGATGG
CAAGGAAGAA GACAAGGCGA AGCACCGGCT GCTCGTTAAA GTAAGAGCAC ACCTCAAAAG CCTTAGAATT ACATGGTTGG
ATCTTGTGAG TTGTGATCAT GGACTAGCTA TTATAATGTT TGTGCCTAGT AAACATGAGT GCGCATCATT TTCTACTTTG
TGAATGAAAT AGTATGAATT ATGCAATGGC TGATGTAACT GTTTTTTTTT TTTTTACTGC AGGAACTTGA TGTGTGGCAG
TGCATGTGTT GTTTAGGACC TGTCTGAATT CTTGAAGGTG TGTAAGCGTT GTGTAATGGC AAGTGAATTT GCTGACTGTT
CTGCTGCTTC CATTTACTAC TACTAAGCTC TTTCGTGTGT TTGAATTACT ACATCTAGAA CTAGAGCATC AGGCTCATAG
ACTGACTTCA TATCAGGTGT TTGTATCATT AATATTATTA TGTAAGAAGG TTGTGGTTTG TGGAACAACT AAATACAACA
ATGCAGGCTA TGTTGTAGTA TGCTCTGCTA CTGGTGTATG TTATAAATAT AAAATTCTGC TACATACTTT TGTGCATCGA
GTCGCCTTTT CTTCTTGTTT CTTGCACAAT GGCAGATATC ATTTTTTTGG TCAGTTTAAA AACGAGAAAC GCTTATAACC
TTTTTCAAAA CAAGGCCAGA AACTATGATT GAGATTATAA TGACATCGTT TGACACACCA CAGTGCCCAC AAGGCTGTTC
AAACTACGAG CTGTTTATTC TGTATTTCTG GCAACACTAA TGAAACCAGA GAAAACGCTT CTGGATTTCT GCATCAGCTA
TGCGATGAAA CCCTTTGAAA TCAGAGCACC TGCTTCATTT TGTAAACATG CTTTTGAGCT TCTCGTTGGC GGATACCAGT
TCGGCAGCAA CACCAACCTC GTTAGCGGAG TGTCCTGCAT CTGGAACCAT CTGTATACGG TAGAAGAGAT TAATTATTGA
CTCAATCAAG TACGCATGAA CAATATTGCA GTCGGCAGTA AGCACATTCT ATCTACACAG AAATCATTCG AAATGCATTT
TATCTAGCGA AGTCAGTAGA TCAGGGTATA TAAATTTAAG GTATACGGTA ATTTGCCAAA ATAACCGTTG CTCATTGCCA
AAAACAATGA GCAGGCAACC TAAATGAGCA GATTACTGTA CTCCTATTTG ACACAGTTAT TTTGGCAATC ATTTACATGA
AAAGAATCAT TTACCTTAAA TTCTGCTTCA GGCCATGCTT TATGAAGATC CCAGGCAGAC ATCATAGGAC AGCAAACATC
ATACCGGCCC TGCAACATAA AAACACCGAT CACTATCAGG TACTACAATA GTATCATCTC ACCTGTATAA CTCTTTGCAC
AAAACTTACA AAATACTCCA CTTTACAGTA GGAGTAGTAG CTATAAAAAG CATCAAGGCC TAATTTGCCA GTCGAGGGAA
CAATTATGAA TAATGCCACT TTACAGTTCC ATTGTCATTA TGCATTGCAT TACAGCACAC AAAATCCATG TCTTCTTGGC
ATCCTACATC TACATGCTAG ATCAAACATT TGGACACGAC AATCAACATC AAATCAGAGG AGCTACAGCT AATCTCCAAC
ATGAGAATTC GATCATGTTT GCTAcaatct attatattat taaaacagct ttgaaagaag gcaccacgtt cgctggaggc
tagaaattct cacattaatc agagaaaaag 

Locus: Os05g0513800

Loading...

Locus: Os05g0513800

Loading...