Os05t0518000-01

Locus

Os05g0518000

Description

Homolog of Hd3a, Promotion of flowering, Drought tolerance

RAP-DB Gene Symbol Synonym(s)

OsFTL10

RAP-DB Gene Name Synonym(s)

Flowering Locus T-like 10

CGSNL Gene Symbol

FTL10

CGSNL Gene Name

FLOWERING TIME LIKE GENE 10

Oryzabase Gene Symbol Synonym(s)

OsFTL10

Oryzabase Gene Name Synonym(s)

FT-like gene 10, Flowering Locus T-like 10

Transcript Evidence

EU241924

Protein Evidence

A0A0N7KL34

Literature

PMID: 30783573

Note

Manual Curation

February 22, 2019

Functional domain (InterPro)

PEBP-like superfamily (IPR036610)

Phosphatidylethanolamine-binding protein (IPR008914)

Phosphatidylethanolamine-binding protein, eukaryotic (IPR035810)

Phosphatidylethanolamine-binding, conserved site (IPR001858)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytoplasm (GO:0005737)

Expression Databases

TENOR (Os05t0518000-00)

Others

Oryzabase (11231)

KEGG (Os05t0518000-00)

Transcript

618 bp

>Os05t0518000-01 Homolog of Hd3a, Promotion of flowering, Drought tolerance
CAATGGATCCTTTGTACCTATCTCAGATCATACCGGATGTGTTGGATCCATTTATTTCAA
CCATTTCACTCAGAGTAACCTACAACAGCAGGCTACTTCTGGCAGGAGCAGCGCTTAAAC
CATCTGCAGTTGTAAGCAAGCCACAGGTTGATGTTGGTGGCAATGACATGAGGGTTTCCT
ACACACTGGTATTGGTGGATCCAGATGCCCCAAGCCCAAGTGACCCATCGCTGAGGGAGT
ACTTGCACTGGATGGTAACAGATATCCCTGAAACAACTTCCATCAGCTTTGGCGAAGAGT
TAATATTATATGAGAAGCCAGAGCCAAGATCAGGCATCCATCGGATGGTATTTGTGCTGT
TCCGCCAACTTGGCAGGCGGACAGTCTTTGCACCGGAAAAACGACATAACTTCAACTGCA
GAATTTTTGCACGCCAACACCACCTCAACATCGTGGCTGCCACATACTTCAACTGTCAAA
GGGAGGCAGGATGGGGTGGAAGAAAGTTTGCGCCTGAAGGCCCTTAAGAGAAGTACTAGC
AAATATAGCCATCACAAATTATGTGCTTATATATACAGAACGCACTGTACTATCTCTATA
TGCAGCACTATATATTTA

CDS

525 bp

>Os05t0518000-01 Homolog of Hd3a, Promotion of flowering, Drought tolerance
ATGGATCCTTTGTACCTATCTCAGATCATACCGGATGTGTTGGATCCATTTATTTCAACC
ATTTCACTCAGAGTAACCTACAACAGCAGGCTACTTCTGGCAGGAGCAGCGCTTAAACCA
TCTGCAGTTGTAAGCAAGCCACAGGTTGATGTTGGTGGCAATGACATGAGGGTTTCCTAC
ACACTGGTATTGGTGGATCCAGATGCCCCAAGCCCAAGTGACCCATCGCTGAGGGAGTAC
TTGCACTGGATGGTAACAGATATCCCTGAAACAACTTCCATCAGCTTTGGCGAAGAGTTA
ATATTATATGAGAAGCCAGAGCCAAGATCAGGCATCCATCGGATGGTATTTGTGCTGTTC
CGCCAACTTGGCAGGCGGACAGTCTTTGCACCGGAAAAACGACATAACTTCAACTGCAGA
ATTTTTGCACGCCAACACCACCTCAACATCGTGGCTGCCACATACTTCAACTGTCAAAGG
GAGGCAGGATGGGGTGGAAGAAAGTTTGCGCCTGAAGGCCCTTAA

Protein

175 aa

>Os05t0518000-01 Homolog of Hd3a, Promotion of flowering, Drought tolerance
MDPLYLSQIIPDVLDPFISTISLRVTYNSRLLLAGAALKPSAVVSKPQVDVGGNDMRVSY
TLVLVDPDAPSPSDPSLREYLHWMVTDIPETTSISFGEELILYEKPEPRSGIHRMVFVLF
RQLGRRTVFAPEKRHNFNCRIFARQHHLNIVAATYFNCQREAGWGGRKFAPEGP*

5'UTR

chr05:25669370..25669371 (- strand) : 2 bp

CDS

chr05:25669184..25669369 (- strand) : 186 bp

chr05:25668904..25668965 (- strand) : 62 bp

chr05:25668705..25668745 (- strand) : 41 bp

chr05:25667455..25667690 (- strand) : 236 bp

3'UTR

chr05:25667364..25667454 (- strand) : 91 bp

FASTA

>Os05t0518000-01 class=Sequence position=chr05:25667364..25669371 (- strand)
CAATGGATCC TTTGTACCTA TCTCAGATCA TACCGGATGT GTTGGATCCA TTTATTTCAA CCATTTCACT CAGAGTAACC
TACAACAGCA GGCTACTTCT GGCAGGAGCA GCGCTTAAAC CATCTGCAGT TGTAAGCAAG CCACAGGTTG ATGTTGGTGG
CAATGACATG AGGGTTTCCT ACACACTGGT AAGCTAGGTG GTTTTAAGAT ATAGCTATCA AAGGGAACAA TATATGTCAA
TCCTATTGTT TCTTTTATAA CTAATATTAC AATCTCTATT GGTAGGATTT TTTAAAAGCT CTTTTGGGAG AAATTTCTAG
TCTATTCTAT TAAGTTTTAT GAAGAATACT TACTAGCAAA ATACAACCTA CCTGCATGAC AACCCGTTTA CCTTCACCTA
AAAAAGGTAT TGGTGGATCC AGATGCCCCA AGCCCAAGTG ACCCATCGCT GAGGGAGTAC TTGCACTGGT AAACCAATCA
CAACATATTG CAGCTATGAC CAATTATGGC AAATTACACC ATTCTTTTTT TGACCCATGC ATTTGACTTT TGATATATAT
ATATATATAT ATACATATAT TTTTAGTCTG CTCTCGTTAT TTATGATGCA ACTGTACTTT TTGTAGGATG GTAACAGATA
TCCCTGAAAC AACTTCCATC AGCTTTGGTA TGATGTGTTT ATATAGCAAA GGGATGTTTG ATGTGGTTTT CTTTTTTAGT
TAATTTTGTC ACTGTGCAGG TTATGTTCCG CAAAGGCTCA AACATGTTAT TACCACTAAA TCATACTAGG ATATCAAGGA
ATAAAAACTG AATGTTACAC AAGCTGTCAG GTGACACTAA TGCATATACA ACTTTTATAA CAAGCTTGAT TCCCTCAAAG
ACACAACTAG GGGCCACTAA TTATAGATCA CAATCACATA ACAAGGCCTT AATTTTGTTT AAATGAGTAA CAAAGATACT
AGGTGCATTT AAACTGTTTT AAAAACAGTT CCTCTTAATG GTACACAAGA GCTCAGAATC TGATAAAAGT TTATAGTGGC
AAGTATCCAT GTTAATGAAG CTAAATATAT CAGAAAGAAT TTTACAACGG GTCATTCTTT GATGACCAAC AATACATAGA
ATGGGGGCTT ATAATATATT GGAATGCCTA AGGATTTGTA TTTCGCTACA TGGAACATAA AGTTTTACTC GAGTTGCACA
CTTTTTACTT GCAGTGAGTG CATCAGTAAA AAATCATTAT AATTTTACGC AAAGTCTGGT ACCATTTAAC TTCAGTAAAA
TCTCAACAGA TTATTCTTGT ATGCTTTTTA TCGGAGTTGT AAAATAAGCT ACTCAAACAC TTACAATAGT GTCATGCTAC
CGCATTTACT TCTCTCACAT GCCAAGTGGT TTCATTTTAT TTGTGGTATT TAGAGGATTT TTGTATTTGT AATATGCGAT
TTTGCTTCTA ACTACCATAC ACTGGAGTAA AAGGTTGCCC TATATATTGG AACAAAAATT TGCTCCTATG GCTTAAACAC
ATATTTCTAT ATCTATAAGA GCTGTATTTG TCTATATCAA AAGAGGCAAC TGCACCATAT ATGGAAATAT GGATGAGTCA
ACCTACATTT GAAGAGAATA AACTGTCTTA TGCTTATAGT CGAGAACTTC ATAAATCCAA AGTGCCCGAA TGACCCTGCA
GGCGAAGAGT TAATATTATA TGAGAAGCCA GAGCCAAGAT CAGGCATCCA TCGGATGGTA TTTGTGCTGT TCCGCCAACT
TGGCAGGCGG ACAGTCTTTG CACCGGAAAA ACGACATAAC TTCAACTGCA GAATTTTTGC ACGCCAACAC CACCTCAACA
TCGTGGCTGC CACATACTTC AACTGTCAAA GGGAGGCAGG ATGGGGTGGA AGAAAGTTTG CGCCTGAAGG CCCTTAAGAG
AAGTACTAGC AAATATAGCC ATCACAAATT ATGTGCTTAT ATATACAGAA CGCACTGTAC TATCTCTATA TGCAGCACTA
TATATTTA

Locus: Os05g0518000

Loading...

Locus: Os05g0518000

Loading...