Os05t0518600-01

Locus

Os05g0518600

Description

Similar to SL-TPS/P.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TPS1

CGSNL Gene Name

TREHALOSE-6-PHOSPHATE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

OsTPS1

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK067066 (DDBJ, Best hit)

Protein Evidence

B6DT12 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: trehalose biosynthetic process (GO:0005992)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Glycosyl transferase, family 20 (IPR001830)

Full-length cDNA

J013093P17 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0518600-01)

RiceXPro (AK067066)

Others

Oryzabase (9040)

KEGG (Os05t0518600-01 (EC:2.4.1.15))

Transcript

2790 bp

>Os05t0518600-01 Similar to SL-TPS/P.
TGTACCAGCACTACAAGGAAGGGGATGTGATCTGGTGCCATGATTACCACCTCATGTTCC
TGCCCAAGTGCCTCAAGGATCATGACATCAACATGAAGGTCGGGTGGTTCCTGCACACGC
CATTCCCTTCTTCGGAGATTTACCGGACGCTGCCCTCCCGGTCGGAGCTGCTTCGCTCCG
TGCTCTGTGCTGATTTAGTCGGATTTCATACATATGATTATGCAAGACATTTTGTGAGCG
CATGTACAAGAATACTTGGACTGGAGGGCACTCCTGAGGGTGTGGAAGACCAAGGAAGGC
TAACCAGAGTTGCTGCGTTTCCTATTGGGATAGACTCTGAACGTTTCAAGCGAGCATTGG
AGCTTCCAGCAGTAAAAAGACACATCACTGAATTAACACAACGTTTTGATGGTCGAAAGG
TAATGCTTGGTGTTGACCGACTTGACATGATCAAAGGAATTCCGCAAAAGATTTTGGCCT
TTGAAAAGTTTCTCGAAGAAAACCATGAATGGAATGATAAAGTGGTTCTACTTCAAATTG
CTGTGCCGACAAGAACTGATGTCCCTGAGTGTATGAGCCCTTCCTGTGTTTTATCTCCTA
TTTATACTTTGTGCGACTCTACAAGCATGTCTGCTGGAGTACCTCAGATGCATGAAATCA
AAAGCTTACAAGTCAGGTGCATGAAATTGTTGGGCGCATAAATGGCCGATTTGGAACACT
GACTGCTGTTCCTATTCATCATCTGGACCGATCTCTTGATTTCCATGCCTTGTGTGCCCT
TTATGCAGTCACTGATGTGGCCCTTGTAACATCGCTGAGAGATGGAATGAATCTTGTAAG
CTATGAATATGTTGCATGCCAAGGATCAAAAAAAGGAGTTTTGATATTGAGTGAGTTTGC
TGGGGCAGCACAGTCTCTTGGAGCCGGTGCTATTTTAGTAAACCCCTGGAATATTACTGA
AGTCGCAGACTCAATCAAGCATGCTTTGACAATGTCATCTGATGAGAGAGAAAAGCGACA
TAGGCATAACTATGCTCATGTGACAACTCACACTGCACAAGATTGGGCCGAAACTTTTGT
ATGTGAGTTAAATGAGACAGTTGCTGAAGCTCAGCTGAGAACAAGACAAGTTCCACCTGA
TCTCCCTAGTCAAGCAGCAATTCAACAATATCTGCATTCCAAAAATCGGTTGCTCATATT
GGGGTTCAATTCAACATTGACTGAGCCAGTTGAATCCTCTGGGAGAAGGGGTGGTGACCA
AATCAAGGAAATGGAGCTCAAGTTGCATCCTGAGTTGAAGGGCCCTTTGAGAGCCCTCTG
TGAGGATGAGCATACTACAGTTATTGTTCTTAGTGGAAGTGACAGGAGCGTCCTTGATGA
AAATTTCGGAGAATTCAATATGTGGTTAGCAGCAGAGCATGGCATGTTTTTACGTCCAAC
TAATGGAGAGTGGATGACAACAATGCCTGAGCATCTGAACATGGATTGGGTAGACAGTGT
AAAGAATGTTTTTGAATACTTTACAGAAAGAACCCCAAGGTCTCATTTTGAACACCGTGA
GACATCATTTGTATGGAATTACAAGTATGCTGATGTTGAGTTTGGACGGCTCCAAGCAAG
AGATATGCTGCAGCACTTGTGGACAGGTCCAATCTCAAATGCAGCAGTCGATGTTGTTCA
AGGAAGCCGATCAGTTGAAGTTCGGTCTGTCGGAGTTACAAAGGGTGCTGCAATTGATCG
TATTCTAGGAGAGATAGTTCATAGCAAAAGCATGATTACTCCAATTGATTATGTTCTATG
CATTGGGCACTTCCTAGGAAAGGATGAGGACATCTATGTCTTTTTCGATCCCGAGTACCC
TTCTGAATCAAAAGTAAAACCAGATAGCAGCGGCTCGGTATCTCTTGACAGGAGGCCAAA
TGGACGACCATCAAACGGCAGGAGCAATTCCAGAAACTCGCAGTCAAGGACACCCAAGGC
ACAGGCTGCTCCGGAGAGGTCATCGTCATCATCTTCATCAAGCCAGGGCACCCCAAACAG
CCACCATGACTGGCGCGAAGGGTCCTCGGTCCTTGACCTCAAGGGCGAGAATTATTTCTC
CTGCGCTGTTGGAAGGAAGCGGTCCAACGCCCGCTACCTGCTTAACTCGTCAGAGGAGGT
CGTCTCCTTCCTCAAGGAGATGGCAGATGCAACGGCGGCTCACAATGGGTTCCAGTCCAC
AACTGCGGATTACATGTTCTTGGATAGGCAGTAGATGTTCTAATCCCCGGTCTTCCCCCA
GAGAAGAAGTTTAACCCTGAAAGTATTCATTCCTTACATGGCCCTGCATGATGTACAATT
GTGTACAAAATTTAAGCTCGTGATAAAACTGCGAGAGGGCAGCAAATGAGAAAGCGTTAA
AATCGTTTAGAGAATTCTGTACAAAATTAAATGCGCTCTCTGCTCCCATAGTGCTGAAAT
GAGCCCACCGCTCTTCTACATTTTTTTTTTGGTCTCGGATCCCGCTATTAGCAGTTTAGT
GATAGATAATAAATCTGTAAACTTTTGTTTTCCTGAATGTTTTCGGCCATAGGTTCTGGA
GCGCGTCATGTTTATTTTTCAAATTCTAGTTCAGGGTCTAGTTCTGAGTTTGTTTTTTTT
TCCTTGTTCGTCTTTAGAGCTAGATGGTGAAGATGGTGGTCACGATGGAGAAAATTACAT
ATCTACTATCGCATAAGATAGGATTCGCTCAAATACCATTATTAAAATGGGCTTCGCTAT
AATACCATTCTCAACCAAGATGTTTTTTCT

CDS

699 bp

>Os05t0518600-01 Similar to SL-TPS/P.
TACCAGCACTACAAGGAAGGGGATGTGATCTGGTGCCATGATTACCACCTCATGTTCCTG
CCCAAGTGCCTCAAGGATCATGACATCAACATGAAGGTCGGGTGGTTCCTGCACACGCCA
TTCCCTTCTTCGGAGATTTACCGGACGCTGCCCTCCCGGTCGGAGCTGCTTCGCTCCGTG
CTCTGTGCTGATTTAGTCGGATTTCATACATATGATTATGCAAGACATTTTGTGAGCGCA
TGTACAAGAATACTTGGACTGGAGGGCACTCCTGAGGGTGTGGAAGACCAAGGAAGGCTA
ACCAGAGTTGCTGCGTTTCCTATTGGGATAGACTCTGAACGTTTCAAGCGAGCATTGGAG
CTTCCAGCAGTAAAAAGACACATCACTGAATTAACACAACGTTTTGATGGTCGAAAGGTA
ATGCTTGGTGTTGACCGACTTGACATGATCAAAGGAATTCCGCAAAAGATTTTGGCCTTT
GAAAAGTTTCTCGAAGAAAACCATGAATGGAATGATAAAGTGGTTCTACTTCAAATTGCT
GTGCCGACAAGAACTGATGTCCCTGAGTGTATGAGCCCTTCCTGTGTTTTATCTCCTATT
TATACTTTGTGCGACTCTACAAGCATGTCTGCTGGAGTACCTCAGATGCATGAAATCAAA
AGCTTACAAGTCAGGTGCATGAAATTGTTGGGCGCATAA

Protein

233 aa

>Os05t0518600-01 Similar to SL-TPS/P.
YQHYKEGDVIWCHDYHLMFLPKCLKDHDINMKVGWFLHTPFPSSEIYRTLPSRSELLRSV
LCADLVGFHTYDYARHFVSACTRILGLEGTPEGVEDQGRLTRVAAFPIGIDSERFKRALE
LPAVKRHITELTQRFDGRKVMLGVDRLDMIKGIPQKILAFEKFLEENHEWNDKVVLLQIA
VPTRTDVPECMSPSCVLSPIYTLCDSTSMSAGVPQMHEIKSLQVRCMKLLGA*

5'UTR

chr05:25714880..25714881 (+ strand) : 2 bp

CDS

chr05:25714882..25715081 (+ strand) : 200 bp

chr05:25715783..25715897 (+ strand) : 115 bp

chr05:25716114..25716215 (+ strand) : 102 bp

chr05:25716882..25717118 (+ strand) : 237 bp

chr05:25717460..25717504 (+ strand) : 45 bp

3'UTR

chr05:25717505..25717548 (+ strand) : 44 bp

chr05:25717816..25717864 (+ strand) : 49 bp

chr05:25718021..25718121 (+ strand) : 101 bp

chr05:25718227..25718414 (+ strand) : 188 bp

chr05:25718583..25718700 (+ strand) : 118 bp

chr05:25719198..25719377 (+ strand) : 180 bp

chr05:25719470..25719592 (+ strand) : 123 bp

chr05:25719666..25719753 (+ strand) : 88 bp

chr05:25719847..25719977 (+ strand) : 131 bp

chr05:25720066..25720164 (+ strand) : 99 bp

chr05:25721120..25722087 (+ strand) : 968 bp

FASTA

>Os05t0518600-01 class=Sequence position=chr05:25714880..25722087 (+ strand)
TGTACCAGCA CTACAAGGAA GGGGATGTGA TCTGGTGCCA TGATTACCAC CTCATGTTCC TGCCCAAGTG CCTCAAGGAT
CATGACATCA ACATGAAGGT CGGGTGGTTC CTGCACACGC CATTCCCTTC TTCGGAGATT TACCGGACGC TGCCCTCCCG
GTCGGAGCTG CTTCGCTCCG TGCTCTGTGC TGATTTAGTC GGGTGAGCAT GCCCTTTGTG CTTATGCCTC CGTTCTGCCT
TCTGACGAAT TTGGTACTGG AAGCAGATGA GTTTTGGTTC ACTATCATTC TGAATTTACA CCTGCGCTTG CTGTCAGACT
AGGCAACCAA GTGACTTTTG TGACTTTGAT CATGTTCAGT GTGTTTCCAA GTCCTAATCA ATCAAAAAGA AAAACAGTTT
GTTAACGATT GTTTGCCATG TCTATATAAT AAAGTTGCTT TTATAGTAGC TTAGAATTCA ATCGGCCAAC TTTATCTCGT
ACGCTGACAG TAAAGGTACA TTTAAAAGGT GACAATGGAT AGTCTAATAC TTGAACTGAC AATAGAGACA CATTACATGT
CAGTTGATTA AGTTTGTAAC AGAAAAATAA ACAATACTAC ATAATTGCAA AGTTTCTTTG ATGTCTTTCT TTCAAGAAAC
ACAAATATAT CAATGCTACA GTATTGCTGA TGAATTTATC CATGTTGAGA TGTTTTTCTG GTTTCTGATC TGATCAGTCT
CAATTGGTGT GCTGTTTCAT TTTCATTTGC TGATGATCGT CCGAGTAGTT AATTCTTACT AATATTTAGA TAATTTGGCA
TACAAGCGAA TCACGTAGAA CATGATACTT TTGAATGAAT TTATCAAAGT TTTATCACTT GGTGAGTTGT TTCATGGTTT
TCCTACTGAT GTCTCTTCTT CAGATTTCAT ACATATGATT ATGCAAGACA TTTTGTGAGC GCATGTACAA GAATACTTGG
ACTGGAGGGC ACTCCTGAGG GTGTGGAAGA CCAAGGAAGG CTAACCAGAG TTGCTGCGGT ACATATCAAC CTTTGTTTAT
TTATTTATTT AACTATTTTA CCTGAACTGT TTGATATTCC TGACGATTCT GTTAGCTTCA TCCACTAATT ATTTTACTTG
CTACTTTAAA AAACATGGCT CATCTTTTTT AAATTATTTT GATTATTTAT AATCTGTTCA AAAGATGTTT GCAGAATGAG
TGATTCTTTT GACTCACTTG GCTGAAATCT TCAGTTTCCT ATTGGGATAG ACTCTGAACG TTTCAAGCGA GCATTGGAGC
TTCCAGCAGT AAAAAGACAC ATCACTGAAT TAACACAACG TTTTGATGGT CGAAAGGTGA GAAAGCACTT GCTCTTCACT
TCTTGATCTG GGGTAGATTA CGAATTTTCC ACTTCTTTTT GCTGATTATA AGCATTAGAT ATGGACAAGA AATCTGAAAC
ATTACTCATG TATCATTCTC ATAGTATTAG AAGTTTCGTA TGTGTTGTAT TAAGTCATCC TACCTATTTC TTACATTGTG
GATCTTGTAA AGTGGGCAAC AGTTTCAAAG AAAGCTCATA GATGATCTTA AGACCTTTAC ATGTGGAGTT CATACTGTAA
ACATCTAACC AAGCTTGTCT TCGTAACAAT TTATAATACT GCTGTCCATG GCGTCCCCTG TTTTGTAGTC AGTGATCTGT
TTCTTTCTTT CAGTCGTATC ACTCTCTTTG TATGGTGTCA AAAATTATTT CTTTAATAAG ATTTAATTAT GCTGAGCTTG
TCCCCTTCAT TACTGATAAG ATGCAGCCAT TATATTTTCC AACTCGCTCT AGTTCCATTA GTCACTTGTT ACTGCTGCTA
ACTTAGAAAT ACCCTGTTGC ATGTCACTTT CTCTGCTGTT AAAGGTCTTT AAATAATAAT TTCCAATTGA TATGCTTTAC
AAGCTTGTTT TGTCAGCATT AAATGATTTA CAAATGCCTA GTATGGTCTT CCCACTATAA CTTTTCCTTG TTGATGTGAT
AGGTAATGCT TGGTGTTGAC CGACTTGACA TGATCAAAGG AATTCCGCAA AAGATTTTGG CCTTTGAAAA GTTTCTCGAA
GAAAACCATG AATGGAATGA TAAAGTGGTT CTACTTCAAA TTGCTGTGCC GACAAGAACT GATGTCCCTG AGTGTATGAG
CCCTTCCTGT GTTTTATCTC CTATTTATAC TTTGTGCGAC TCTACAAGCA TGTCTGCTGG AGTACCTCAG ATGCATGAAG
TATGACTTCT CCATGTAAAT GAATTATCAA TATTTATCAG CTTGCAGTCT TCTTTCTTAA AAAAAAAACA TTCTTCTTAA
AATCTGAACG AAGTTGCAGT TCAATAACTT TGTTATTGAT TATGGATTCA ATAAGTCTTA CTTGTGAGAT CATATTAGGT
GAGAGTGGCT CATATTATCT ACCTATCCAT TTGAAAATGG GGCTGAAGTC CTATAAGAAC CTAGTTAGAA AGATTGTTTC
TCAACCTTAT TTCCTAAGTT TGGTGTTATG TGATTGAACT GGAAATCTAA CCTGATTATT TGTGGTCATT TTAACTAACC
TTAGAACATG TCATGAGCAG ATCAAAAGCT TACAAGTCAG GTGCATGAAA TTGTTGGGCG CATAAATGGC CGATTTGGAA
CACTGACTGC TGTTCCTATT CATCATCTGG TTAGTTTTGT TTCTTGTCCT TGTTAACTTC ATTTTTGCGC TATCACAAAA
ACATACATCC TTCAGTCATA TTTGCCTCTT CTCTAGTAGG TAAAATGGCA CTTGTGATAC CCATATTTTC TATGATGACT
ATACCTAACC TATCACTATT TAAATAATAA AACAAGTCAG ATTTTAGTTC CTTGTTTCAC TCTACCTTGA GCATATTTCA
TGCTTATTTT TTATGAGAAG TTATTGTATC ATCTAAAAAC ATTGCACTCC TTGCAGGACC GATCTCTTGA TTTCCATGCC
TTGTGTGCCC TTTATGCAGT CACTGGTAAT TATAGGCTCC TCTTTTGATA TTAAAATTTT ACTCATGACA ATAACTCCTG
CTTTGTAATG ATCACATTTG AGTGTGTTGA TAGGAATGTT CCTTCAGTAT TTTAGTGACT CTTGCCAAGC TTGATCTGTG
CATTTCCTCT GTTTTCTTCA GATGTGGCCC TTGTAACATC GCTGAGAGAT GGAATGAATC TTGTAAGCTA TGAATATGTT
GCATGCCAAG GATCAAAAAA AGGAGTTTTG ATATTGAGTG AGGTGAGCTG TCAGTTGTGA TGATCAATAA CCTTTGATCA
CTCCTGAATT TCCATGCTAT TCATATCCAT TCTGCTGGTT CATACTTTTC TATTACTGTA ATTTCAGTTT GCTGGGGCAG
CACAGTCTCT TGGAGCCGGT GCTATTTTAG TAAACCCCTG GAATATTACT GAAGTCGCAG ACTCAATCAA GCATGCTTTG
ACAATGTCAT CTGATGAGAG AGAAAAGCGA CATAGGCATA ACTATGCTCA TGTGACAACT CACACTGCAC AAGATTGGGC
CGAAACTTTT GTATGGTGAG TAGTTCATTC CAATTGCCTG ATCTGTAGAG CTTGTTTCCA ATGGTCTGAT TCGTAGTCTG
CTAGATTGGA CCTTATTCGT TGATTTGATG CTTGCTATTC GACTGTACAT TTTGTTTTCC CTTGTTTGAC TGTCTAAATA
TTGTGCTGCG TCTTTTCATG TAGTGAGTTA AATGAGACAG TTGCTGAAGC TCAGCTGAGA ACAAGACAAG TTCCACCTGA
TCTCCCTAGT CAAGCAGCAA TTCAACAATA TCTGCATTCC AAAAATCGGT TGCTCATATT GGTATTACCA TATTTCTTCT
TTGCTACCTT CTGTTGGCTG GGCTGTTCTG ATGCAAAAAT TGCTTGTTTA TTCTTATCTT TTTTTGACGT AAATATTTAT
TCTTGTCTGA TAGCAATTTC TTTACATAGT TGCTTTGATT TGTGCTCTTA TGCACATATT GCCTTCACTC TGAAATGATT
GGCCTTAATC TTGCTGAAAT AGTTGCTATG ACTTATGCAC CTTTTCTTGT TCAAGTAATT AAATTTAAAA TCTATAAAAT
TGAACTATTT AATTTAAATA TTACTGATTG TCCGATGATT TTTTTGGGAA GTCCAGTGAA AGCATTTTTT TTTTAAAAAA
AAACTCAGCT TTAGTTTATT TGTTTGGTTG CACTTTCAAG TTTCAACCAC TTTAAGTCGC ATACAAGTGA TCTGTTCAGC
TTTCTCTTAA AAAAATAATA AACTTAATTG CACTTTGACA GTAGCATTTG TATTTACCCT TTTTTTTTTA CAATGTAGGG
GTTCAATTCA ACATTGACTG AGCCAGTTGA ATCCTCTGGG AGAAGGGGTG GTGACCAAAT CAAGGAAATG GAGCTCAAGT
TGCATCCTGA GTTGAAGGGC CCTTTGAGAG CCCTCTGTGA GGATGAGCAT ACTACAGTTA TTGTTCTTAG TGGAAGTGAC
AGGAGCGTCC TTGATGAAGT AATTATCAGA TTTTTCCTGT CTTTTTTCGT ACAATAGATT GAGTACGCTA CTATATTTCC
ATCAAAACTA ACATATATCT TCCCATGCAG AATTTCGGAG AATTCAATAT GTGGTTAGCA GCAGAGCATG GCATGTTTTT
ACGTCCAACT AATGGAGAGT GGATGACAAC AATGCCTGAG CATCTGAACA TGGATTGGGT AGACAGTGTA AAGGTGTGTA
TTTGATAAAT AATGTCTGCT GCAACCACTT GATGAATGCC TTCTGACATT GTGTATTGCT TTCCAGAATG TTTTTGAATA
CTTTACAGAA AGAACCCCAA GGTCTCATTT TGAACACCGT GAGACATCAT TTGTATGGAA TTACAAGTAT GCTGGTACGT
GTTTATGCTT GATTGCTCCT TTAGTTTTAA TTAGAGAAGG CCTGCAATAT AAAAGCTTAA TGCTATTTTC GTTTTCCCAT
TGCAAAGATG TTGAGTTTGG ACGGCTCCAA GCAAGAGATA TGCTGCAGCA CTTGTGGACA GGTCCAATCT CAAATGCAGC
AGTCGATGTT GTTCAAGGAA GCCGATCAGT TGAAGTTCGG TCTGTCGGAG TTACAAAGGT CAGTGGTTCA GTGTGATGCC
TCATGATAAT TGAAAGTTTA CACTTTGTTG TTAGCGGATG TTTGAAAAAT TATGTTCTTT CCACAGGGTG CTGCAATTGA
TCGTATTCTA GGAGAGATAG TTCATAGCAA AAGCATGATT ACTCCAATTG ATTATGTTCT ATGCATTGGG CACTTCCTAG
GAAAGGTAAT TATGCAATTA ATTTATATGT GCATATCCGT TTCTTTCAGT GCAAGGTGCT TTTTTTGTCT TTGATGTTTC
AATTATCTCG TGTGGCGTGA TGCGTGCAAA TCTATAAAGT TTGGATTGGT CTTATATAGA TGTTGTGACA CTATTTCATT
GGTTGTTTAG AACAAAATCC AAAGTGGGGA GGACACGTCC CCAAATAACC TCATTAGCCC CTTGCAAATT TATATGTGGA
AGAAGTGGGA TTTGTGGGAA TGGGTATAAA AGTTTCTTTG GTATCTTTCT TTCTTACACA CGAAAAGAAG GGAAAAATTA
CCTCCTAGCA AAGCACAAAC CGTTCTTTTG GTTTACTTAC GAAAATAATG TTTTAACTCA ACAAAATTTA AGCAATGTTC
ATATCGTCAA TGCTGTTGTA CTGATGCACA AATAAAAGTT TTTTTGAGAA TGTGCAAAAG AATTGCACAT CTTTTGTATT
AAGAATGAAG GAGAGTGGCA ACAACTTTAC ATCCTCTTTA GAAAACGAAA AGAAAAGGAG AAAACACACA AAGCACATTA
GAGAGATATC TTGCATCATC CATTTTGCGA CCGAAGAGCA CGAATCCTCC TACTCCGGCA ACAGGCCGGC CTTCCTCCAA
AGGGTGGCTT TTTCAGCCAC CGCTCTTGCT ACCTCGTGCC ACGACCTTTG CTGTTGATTG AACACCCTAT GGATATACAA
CAGTTTGAAA TGTTTCGGAG TTACCGAATT GAAACTGCAC AAGCTATTTA CTCTAACATT GGAACATGTA ATAATTTTTG
CCATATAGCA TGCACGTTTC CTACTATTCA ATACGAAGTT TGGAGCCTTT CGTGCTTTTA AAACTGAAGG AATTGTCTTC
TTTCTTGTGC ATTCTTGTAC TCTTCCTGCA CTTGTTCGAT TAATCATTGG CTTTCTTTGG TAACATTGTC TCTTTTTCAG
GATGAGGACA TCTATGTCTT TTTCGATCCC GAGTACCCTT CTGAATCAAA AGTAAAACCA GATAGCAGCG GCTCGGTATC
TCTTGACAGG AGGCCAAATG GACGACCATC AAACGGCAGG AGCAATTCCA GAAACTCGCA GTCAAGGACA CCCAAGGCAC
AGGCTGCTCC GGAGAGGTCA TCGTCATCAT CTTCATCAAG CCAGGGCACC CCAAACAGCC ACCATGACTG GCGCGAAGGG
TCCTCGGTCC TTGACCTCAA GGGCGAGAAT TATTTCTCCT GCGCTGTTGG AAGGAAGCGG TCCAACGCCC GCTACCTGCT
TAACTCGTCA GAGGAGGTCG TCTCCTTCCT CAAGGAGATG GCAGATGCAA CGGCGGCTCA CAATGGGTTC CAGTCCACAA
CTGCGGATTA CATGTTCTTG GATAGGCAGT AGATGTTCTA ATCCCCGGTC TTCCCCCAGA GAAGAAGTTT AACCCTGAAA
GTATTCATTC CTTACATGGC CCTGCATGAT GTACAATTGT GTACAAAATT TAAGCTCGTG ATAAAACTGC GAGAGGGCAG
CAAATGAGAA AGCGTTAAAA TCGTTTAGAG AATTCTGTAC AAAATTAAAT GCGCTCTCTG CTCCCATAGT GCTGAAATGA
GCCCACCGCT CTTCTACATT TTTTTTTTGG TCTCGGATCC CGCTATTAGC AGTTTAGTGA TAGATAATAA ATCTGTAAAC
TTTTGTTTTC CTGAATGTTT TCGGCCATAG GTTCTGGAGC GCGTCATGTT TATTTTTCAA ATTCTAGTTC AGGGTCTAGT
TCTGAGTTTG TTTTTTTTTC CTTGTTCGTC TTTAGAGCTA GATGGTGAAG ATGGTGGTCA CGATGGAGAA AATTACATAT
CTACTATCGC ATAAGATAGG ATTCGCTCAA ATACCATTAT TAAAATGGGC TTCGCTATAA TACCATTCTC AACCAAGATG
TTTTTTCT

Locus: Os05g0518600

Loading...

Locus: Os05g0518600

Loading...