Os05t0518600-02

Locus

Os05g0518600

Description

Trehalose-6-phosphate synthase, Abiotic stress tolerance

RAP-DB Gene Symbol Synonym(s)

OsTPS1

RAP-DB Gene Name Synonym(s)

trehalose-6-phosphate synthase 1

CGSNL Gene Symbol

TPS1

CGSNL Gene Name

TREHALOSE-6-PHOSPHATE SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

OsTPS1

Oryzabase Gene Name Synonym(s)

Transcript Evidence

HM050424 (indica)

Protein Evidence

H6ST13 (indica)

Literature

PMID: 21698458

PMID: 21598083

Note

Manual Curation

November 9, 2018

Gene Ontology (GO)

Biological Process: trehalose biosynthetic process (GO:0005992)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity (GO:0003825)

Functional domain (InterPro)

HAD-like superfamily (IPR036412)

HAD superfamily (IPR023214)

Trehalose-phosphatase (IPR003337)

Glycosyl transferase, family 20 (IPR001830)

Alpha,alpha-trehalose-phosphate synthase (IPR012766)

Others

Oryzabase (9040)

Transcript

2943 bp

>Os05t0518600-02 Trehalose-6-phosphate synthase, Abiotic stress tolerance
ATGCCGACCCCCGCGCCGTCGGCATCGTCCTCCTCCTCCTCCTGCGGCGGCGGTGGCGGT
GGCGCCGGGGCCGCGTCGTCCTACTCCTCCTCCCCGGACGACCGCATGCTCCGCGGGGAG
TGCGGCCGCCGCCACCCCTTCGCGTCGTCGGCGGCGGTGGGGGCCGGTTCCCCGGACGCC
ATGGACACGGACTCCGCGGAGCCTTCCTCCGCGGCGACCTCCGTCGCGGACTTCGGGGCC
CGGTCGCCGTTCTCGCCGGGGGCCGCCTCGCCCGCCAACATGGACGACGCGGGCGGCGCG
TCGGCGGCGGGGCACGCGGCGCGGCCGCCGCTCGCCGGGCCGCGCAGCGGGTTCCGCCGC
CTCGGCCTCCGCGGGATGAAGCAGCGCCTCCTCGTCGTCGCCAACCGCCTCCCCGTCTCC
GCCAATCGCCGCGGCGAGGACCAGTGGTCCCTGGAGATCAGCGCCGGCGGCCTCGTCAGC
GCCCTCCTCGGCGTCAAGGACGTGGACGCGAAGTGGATCGGATGGGCGGGCGTCAACGTC
CCCGACGAGGTCGGCCAGCGAGCTCTCACCCGAGCGCTCGCCGAGAAGAGATGTATACCA
GTGTTCCTGGATGAGGAAATCGTGCACCAATACTACAACGGATACTGCAACAACATACTC
TGGCCTCTGTTTCACTACCTGGGATTGCCACAGGAGGACAGGTTGGCGACGACGAGGAAT
TTCGAGTCACAGTTCAACGCGTACAAGCGAGCAAACCAGATGTTCGCTGATGTTGTGTAC
CAGCACTACAAGGAAGGGGATGTGATCTGGTGCCATGATTACCACCTCATGTTCCTGCCC
AAGTGCCTCAAGGATCATGACATCAACATGAAGGTCGGGTGGTTCCTGCACACGCCATTC
CCTTCTTCGGAGATTTACCGGACGCTGCCCTCCCGGTCGGAGCTGCTTCGCTCCGTGCTC
TGTGCTGATTTAGTCGGATTTCATACATATGATTATGCAAGACATTTTGTGAGCGCATGT
ACAAGAATACTTGGACTGGAGGGCACTCCTGAGGGTGTGGAAGACCAAGGAAGGCTAACC
AGAGTTGCTGCGTTTCCTATTGGGATAGACTCTGAACGTTTCAAGCGAGCATTGGAGCTT
CCAGCAGTAAAAAGACACATCACTGAATTAACACAACGTTTTGATGGTCGAAAGGTAATG
CTTGGTGTTGACCGACTTGACATGATCAAAGGAATTCCGCAAAAGATTTTGGCCTTTGAA
AAGTTTCTCGAAGAAAACCATGAATGGAATGATAAAGTGGTTCTACTTCAAATTGCTGTG
CCGACAAGAACTGATGTCCCTGAGTATCAAAAGCTTACAAGTCAGGTGCATGAAATTGTT
GGGCGCATAAATGGCCGATTTGGAACACTGACTGCTGTTCCTATTCATCATCTGGACCGA
TCTCTTGATTTCCATGCCTTGTGTGCCCTTTATGCAGTCACTGATGTGGCCCTTGTAACA
TCGCTGAGAGATGGAATGAATCTTGTAAGCTATGAATATGTTGCATGCCAAGGATCAAAA
AAAGGAGTTTTGATATTGAGTGAGTTTGCTGGGGCAGCACAGTCTCTTGGAGCCGGTGCT
ATTTTAGTAAACCCCTGGAATATTACTGAAGTCGCAGACTCAATCAAGCATGCTTTGACA
ATGTCATCTGATGAGAGAGAAAAGCGACATAGGCATAACTATGCTCATGTGACAACTCAC
ACTGCACAAGATTGGGCCGAAACTTTTGTATGTGAGTTAAATGAGACAGTTGCTGAAGCT
CAGCTGAGAACAAGACAAGTTCCACCTGATCTCCCTAGTCAAGCAGCAATTCAACAATAT
CTGCATTCCAAAAATCGGTTGCTCATATTGGGGTTCAATTCAACATTGACTGAGCCAGTT
GAATCCTCTGGGAGAAGGGGTGGTGACCAAATCAAGGAAATGGAGCTCAAGTTGCATCCT
GAGTTGAAGGGCCCTTTGAGAGCCCTCTGTGAGGATGAGCATACTACAGTTATTGTTCTT
AGTGGAAGTGACAGGAGCGTCCTTGATGAAAATTTCGGAGAATTCAATATGTGGTTAGCA
GCAGAGCATGGCATGTTTTTACGTCCAACTAATGGAGAGTGGATGACAACAATGCCTGAG
CATCTGAACATGGATTGGGTAGACAGTGTAAAGAATGTTTTTGAATACTTTACAGAAAGA
ACCCCAAGGTCTCATTTTGAACACCGTGAGACATCATTTGTATGGAATTACAAGTATGCT
GATGTTGAGTTTGGACGGCTCCAAGCAAGAGATATGCTGCAGCACTTGTGGACAGGTCCA
ATCTCAAATGCAGCAGTCGATGTTGTTCAAGGAAGCCGATCAGTTGAAGTTCGGTCTGTC
GGAGTTACAAAGGGTGCTGCAATTGATCGTATTCTAGGAGAGATAGTTCATAGCAAAAGC
ATGATTACTCCAATTGATTATGTTCTATGCATTGGGCACTTCCTAGGAAAGGATGAGGAC
ATCTATGTCTTTTTCGATCCCGAGTACCCTTCTGAATCAAAAGTAAAACCAGATAGCAGC
GGCTCGGTATCTCTTGACAGGAGGCCAAATGGACGACCATCAAACGGCAGGAGCAATTCC
AGAAACTCGCAGTCAAGGACACCCAAGGCACAGGCTGCTCCGGAGAGGTCATCGTCATCA
TCTTCATCAAGCCAGGGCACCCCAAACAGCCACCATGACTGGCGCGAAGGGTCCTCGGTC
CTTGACCTCAAGGGCGAGAATTATTTCTCCTGCGCTGTTGGAAGGAAGCGGTCCAACGCC
CGCTACCTGCTTAACTCGTCAGAGGAGGTCGTCTCCTTCCTCAAGGAGATGGCAGATGCA
ACGGCGGCTCACAATGGGTTCCAGTCCACAACTGCGGATTACATGTTCTTGGATAGGCAG
TAG

CDS

2943 bp

>Os05t0518600-02 Trehalose-6-phosphate synthase, Abiotic stress tolerance
ATGCCGACCCCCGCGCCGTCGGCATCGTCCTCCTCCTCCTCCTGCGGCGGCGGTGGCGGT
GGCGCCGGGGCCGCGTCGTCCTACTCCTCCTCCCCGGACGACCGCATGCTCCGCGGGGAG
TGCGGCCGCCGCCACCCCTTCGCGTCGTCGGCGGCGGTGGGGGCCGGTTCCCCGGACGCC
ATGGACACGGACTCCGCGGAGCCTTCCTCCGCGGCGACCTCCGTCGCGGACTTCGGGGCC
CGGTCGCCGTTCTCGCCGGGGGCCGCCTCGCCCGCCAACATGGACGACGCGGGCGGCGCG
TCGGCGGCGGGGCACGCGGCGCGGCCGCCGCTCGCCGGGCCGCGCAGCGGGTTCCGCCGC
CTCGGCCTCCGCGGGATGAAGCAGCGCCTCCTCGTCGTCGCCAACCGCCTCCCCGTCTCC
GCCAATCGCCGCGGCGAGGACCAGTGGTCCCTGGAGATCAGCGCCGGCGGCCTCGTCAGC
GCCCTCCTCGGCGTCAAGGACGTGGACGCGAAGTGGATCGGATGGGCGGGCGTCAACGTC
CCCGACGAGGTCGGCCAGCGAGCTCTCACCCGAGCGCTCGCCGAGAAGAGATGTATACCA
GTGTTCCTGGATGAGGAAATCGTGCACCAATACTACAACGGATACTGCAACAACATACTC
TGGCCTCTGTTTCACTACCTGGGATTGCCACAGGAGGACAGGTTGGCGACGACGAGGAAT
TTCGAGTCACAGTTCAACGCGTACAAGCGAGCAAACCAGATGTTCGCTGATGTTGTGTAC
CAGCACTACAAGGAAGGGGATGTGATCTGGTGCCATGATTACCACCTCATGTTCCTGCCC
AAGTGCCTCAAGGATCATGACATCAACATGAAGGTCGGGTGGTTCCTGCACACGCCATTC
CCTTCTTCGGAGATTTACCGGACGCTGCCCTCCCGGTCGGAGCTGCTTCGCTCCGTGCTC
TGTGCTGATTTAGTCGGATTTCATACATATGATTATGCAAGACATTTTGTGAGCGCATGT
ACAAGAATACTTGGACTGGAGGGCACTCCTGAGGGTGTGGAAGACCAAGGAAGGCTAACC
AGAGTTGCTGCGTTTCCTATTGGGATAGACTCTGAACGTTTCAAGCGAGCATTGGAGCTT
CCAGCAGTAAAAAGACACATCACTGAATTAACACAACGTTTTGATGGTCGAAAGGTAATG
CTTGGTGTTGACCGACTTGACATGATCAAAGGAATTCCGCAAAAGATTTTGGCCTTTGAA
AAGTTTCTCGAAGAAAACCATGAATGGAATGATAAAGTGGTTCTACTTCAAATTGCTGTG
CCGACAAGAACTGATGTCCCTGAGTATCAAAAGCTTACAAGTCAGGTGCATGAAATTGTT
GGGCGCATAAATGGCCGATTTGGAACACTGACTGCTGTTCCTATTCATCATCTGGACCGA
TCTCTTGATTTCCATGCCTTGTGTGCCCTTTATGCAGTCACTGATGTGGCCCTTGTAACA
TCGCTGAGAGATGGAATGAATCTTGTAAGCTATGAATATGTTGCATGCCAAGGATCAAAA
AAAGGAGTTTTGATATTGAGTGAGTTTGCTGGGGCAGCACAGTCTCTTGGAGCCGGTGCT
ATTTTAGTAAACCCCTGGAATATTACTGAAGTCGCAGACTCAATCAAGCATGCTTTGACA
ATGTCATCTGATGAGAGAGAAAAGCGACATAGGCATAACTATGCTCATGTGACAACTCAC
ACTGCACAAGATTGGGCCGAAACTTTTGTATGTGAGTTAAATGAGACAGTTGCTGAAGCT
CAGCTGAGAACAAGACAAGTTCCACCTGATCTCCCTAGTCAAGCAGCAATTCAACAATAT
CTGCATTCCAAAAATCGGTTGCTCATATTGGGGTTCAATTCAACATTGACTGAGCCAGTT
GAATCCTCTGGGAGAAGGGGTGGTGACCAAATCAAGGAAATGGAGCTCAAGTTGCATCCT
GAGTTGAAGGGCCCTTTGAGAGCCCTCTGTGAGGATGAGCATACTACAGTTATTGTTCTT
AGTGGAAGTGACAGGAGCGTCCTTGATGAAAATTTCGGAGAATTCAATATGTGGTTAGCA
GCAGAGCATGGCATGTTTTTACGTCCAACTAATGGAGAGTGGATGACAACAATGCCTGAG
CATCTGAACATGGATTGGGTAGACAGTGTAAAGAATGTTTTTGAATACTTTACAGAAAGA
ACCCCAAGGTCTCATTTTGAACACCGTGAGACATCATTTGTATGGAATTACAAGTATGCT
GATGTTGAGTTTGGACGGCTCCAAGCAAGAGATATGCTGCAGCACTTGTGGACAGGTCCA
ATCTCAAATGCAGCAGTCGATGTTGTTCAAGGAAGCCGATCAGTTGAAGTTCGGTCTGTC
GGAGTTACAAAGGGTGCTGCAATTGATCGTATTCTAGGAGAGATAGTTCATAGCAAAAGC
ATGATTACTCCAATTGATTATGTTCTATGCATTGGGCACTTCCTAGGAAAGGATGAGGAC
ATCTATGTCTTTTTCGATCCCGAGTACCCTTCTGAATCAAAAGTAAAACCAGATAGCAGC
GGCTCGGTATCTCTTGACAGGAGGCCAAATGGACGACCATCAAACGGCAGGAGCAATTCC
AGAAACTCGCAGTCAAGGACACCCAAGGCACAGGCTGCTCCGGAGAGGTCATCGTCATCA
TCTTCATCAAGCCAGGGCACCCCAAACAGCCACCATGACTGGCGCGAAGGGTCCTCGGTC
CTTGACCTCAAGGGCGAGAATTATTTCTCCTGCGCTGTTGGAAGGAAGCGGTCCAACGCC
CGCTACCTGCTTAACTCGTCAGAGGAGGTCGTCTCCTTCCTCAAGGAGATGGCAGATGCA
ACGGCGGCTCACAATGGGTTCCAGTCCACAACTGCGGATTACATGTTCTTGGATAGGCAG
TAG

Protein

981 aa

>Os05t0518600-02 Trehalose-6-phosphate synthase, Abiotic stress tolerance
MPTPAPSASSSSSSCGGGGGGAGAASSYSSSPDDRMLRGECGRRHPFASSAAVGAGSPDA
MDTDSAEPSSAATSVADFGARSPFSPGAASPANMDDAGGASAAGHAARPPLAGPRSGFRR
LGLRGMKQRLLVVANRLPVSANRRGEDQWSLEISAGGLVSALLGVKDVDAKWIGWAGVNV
PDEVGQRALTRALAEKRCIPVFLDEEIVHQYYNGYCNNILWPLFHYLGLPQEDRLATTRN
FESQFNAYKRANQMFADVVYQHYKEGDVIWCHDYHLMFLPKCLKDHDINMKVGWFLHTPF
PSSEIYRTLPSRSELLRSVLCADLVGFHTYDYARHFVSACTRILGLEGTPEGVEDQGRLT
RVAAFPIGIDSERFKRALELPAVKRHITELTQRFDGRKVMLGVDRLDMIKGIPQKILAFE
KFLEENHEWNDKVVLLQIAVPTRTDVPEYQKLTSQVHEIVGRINGRFGTLTAVPIHHLDR
SLDFHALCALYAVTDVALVTSLRDGMNLVSYEYVACQGSKKGVLILSEFAGAAQSLGAGA
ILVNPWNITEVADSIKHALTMSSDEREKRHRHNYAHVTTHTAQDWAETFVCELNETVAEA
QLRTRQVPPDLPSQAAIQQYLHSKNRLLILGFNSTLTEPVESSGRRGGDQIKEMELKLHP
ELKGPLRALCEDEHTTVIVLSGSDRSVLDENFGEFNMWLAAEHGMFLRPTNGEWMTTMPE
HLNMDWVDSVKNVFEYFTERTPRSHFEHRETSFVWNYKYADVEFGRLQARDMLQHLWTGP
ISNAAVDVVQGSRSVEVRSVGVTKGAAIDRILGEIVHSKSMITPIDYVLCIGHFLGKDED
IYVFFDPEYPSESKVKPDSSGSVSLDRRPNGRPSNGRSNSRNSQSRTPKAQAAPERSSSS
SSSSQGTPNSHHDWREGSSVLDLKGENYFSCAVGRKRSNARYLLNSSEEVVSFLKEMADA
TAAHNGFQSTTADYMFLDRQ*

CDS

chr05:25713833..25714322 (+ strand) : 490 bp

chr05:25714437..25714534 (+ strand) : 98 bp

chr05:25714693..25715081 (+ strand) : 389 bp

chr05:25715783..25715897 (+ strand) : 115 bp

chr05:25716114..25716215 (+ strand) : 102 bp

chr05:25716882..25717032 (+ strand) : 151 bp

chr05:25717460..25717548 (+ strand) : 89 bp

chr05:25717816..25717864 (+ strand) : 49 bp

chr05:25718021..25718121 (+ strand) : 101 bp

chr05:25718227..25718414 (+ strand) : 188 bp

chr05:25718583..25718700 (+ strand) : 118 bp

chr05:25719198..25719377 (+ strand) : 180 bp

chr05:25719470..25719592 (+ strand) : 123 bp

chr05:25719666..25719753 (+ strand) : 88 bp

chr05:25719847..25719977 (+ strand) : 131 bp

chr05:25720066..25720164 (+ strand) : 99 bp

chr05:25721120..25721551 (+ strand) : 432 bp

FASTA

>Os05t0518600-02 class=Sequence position=chr05:25713833..25721551 (+ strand)
ATGCCGACCC CCGCGCCGTC GGCATCGTCC TCCTCCTCCT CCTGCGGCGG CGGTGGCGGT GGCGCCGGGG CCGCGTCGTC
CTACTCCTCC TCCCCGGACG ACCGCATGCT CCGCGGGGAG TGCGGCCGCC GCCACCCCTT CGCGTCGTCG GCGGCGGTGG
GGGCCGGTTC CCCGGACGCC ATGGACACGG ACTCCGCGGA GCCTTCCTCC GCGGCGACCT CCGTCGCGGA CTTCGGGGCC
CGGTCGCCGT TCTCGCCGGG GGCCGCCTCG CCCGCCAACA TGGACGACGC GGGCGGCGCG TCGGCGGCGG GGCACGCGGC
GCGGCCGCCG CTCGCCGGGC CGCGCAGCGG GTTCCGCCGC CTCGGCCTCC GCGGGATGAA GCAGCGCCTC CTCGTCGTCG
CCAACCGCCT CCCCGTCTCC GCCAATCGCC GCGGCGAGGA CCAGTGGTCC CTGGAGATCA GCGCCGGCGG CCTCGTCAGC
GCCCTCCTCG GTGAGTGCGA TCCCGAAATC TCGCCCTTAT CCCAAATGTG ATGTGCTGGA GCGATGCATG CATCGGCTAT
CCTGCACTGC ATCTTCATCT CGAAAATTTT CACCGACGCT GCAGGCGTCA AGGACGTGGA CGCGAAGTGG ATCGGATGGG
CGGGCGTCAA CGTCCCCGAC GAGGTCGGCC AGCGAGCTCT CACCCGAGCG CTCGCCGAGA AGGTTCGTCG CTGCAACTCG
GGACAAATTT CCCTTTCTGT CTCAACTCTG AAGTCTGAAC CAATAGAACA GTGACTGTTT TGTTATCACT CTAGTACTAG
TTGGAATCAT ATGTGTCTAT GGAGTATATT TTTTCTTTTC TGATTGATTG AACGGAACAG AGATGTATAC CAGTGTTCCT
GGATGAGGAA ATCGTGCACC AATACTACAA CGGATACTGC AACAACATAC TCTGGCCTCT GTTTCACTAC CTGGGATTGC
CACAGGAGGA CAGGTTGGCG ACGACGAGGA ATTTCGAGTC ACAGTTCAAC GCGTACAAGC GAGCAAACCA GATGTTCGCT
GATGTTGTGT ACCAGCACTA CAAGGAAGGG GATGTGATCT GGTGCCATGA TTACCACCTC ATGTTCCTGC CCAAGTGCCT
CAAGGATCAT GACATCAACA TGAAGGTCGG GTGGTTCCTG CACACGCCAT TCCCTTCTTC GGAGATTTAC CGGACGCTGC
CCTCCCGGTC GGAGCTGCTT CGCTCCGTGC TCTGTGCTGA TTTAGTCGGG TGAGCATGCC CTTTGTGCTT ATGCCTCCGT
TCTGCCTTCT GACGAATTTG GTACTGGAAG CAGATGAGTT TTGGTTCACT ATCATTCTGA ATTTACACCT GCGCTTGCTG
TCAGACTAGG CAACCAAGTG ACTTTTGTGA CTTTGATCAT GTTCAGTGTG TTTCCAAGTC CTAATCAATC AAAAAGAAAA
ACAGTTTGTT AACGATTGTT TGCCATGTCT ATATAATAAA GTTGCTTTTA TAGTAGCTTA GAATTCAATC GGCCAACTTT
ATCTCGTACG CTGACAGTAA AGGTACATTT AAAAGGTGAC AATGGATAGT CTAATACTTG AACTGACAAT AGAGACACAT
TACATGTCAG TTGATTAAGT TTGTAACAGA AAAATAAACA ATACTACATA ATTGCAAAGT TTCTTTGATG TCTTTCTTTC
AAGAAACACA AATATATCAA TGCTACAGTA TTGCTGATGA ATTTATCCAT GTTGAGATGT TTTTCTGGTT TCTGATCTGA
TCAGTCTCAA TTGGTGTGCT GTTTCATTTT CATTTGCTGA TGATCGTCCG AGTAGTTAAT TCTTACTAAT ATTTAGATAA
TTTGGCATAC AAGCGAATCA CGTAGAACAT GATACTTTTG AATGAATTTA TCAAAGTTTT ATCACTTGGT GAGTTGTTTC
ATGGTTTTCC TACTGATGTC TCTTCTTCAG ATTTCATACA TATGATTATG CAAGACATTT TGTGAGCGCA TGTACAAGAA
TACTTGGACT GGAGGGCACT CCTGAGGGTG TGGAAGACCA AGGAAGGCTA ACCAGAGTTG CTGCGGTACA TATCAACCTT
TGTTTATTTA TTTATTTAAC TATTTTACCT GAACTGTTTG ATATTCCTGA CGATTCTGTT AGCTTCATCC ACTAATTATT
TTACTTGCTA CTTTAAAAAA CATGGCTCAT CTTTTTTAAA TTATTTTGAT TATTTATAAT CTGTTCAAAA GATGTTTGCA
GAATGAGTGA TTCTTTTGAC TCACTTGGCT GAAATCTTCA GTTTCCTATT GGGATAGACT CTGAACGTTT CAAGCGAGCA
TTGGAGCTTC CAGCAGTAAA AAGACACATC ACTGAATTAA CACAACGTTT TGATGGTCGA AAGGTGAGAA AGCACTTGCT
CTTCACTTCT TGATCTGGGG TAGATTACGA ATTTTCCACT TCTTTTTGCT GATTATAAGC ATTAGATATG GACAAGAAAT
CTGAAACATT ACTCATGTAT CATTCTCATA GTATTAGAAG TTTCGTATGT GTTGTATTAA GTCATCCTAC CTATTTCTTA
CATTGTGGAT CTTGTAAAGT GGGCAACAGT TTCAAAGAAA GCTCATAGAT GATCTTAAGA CCTTTACATG TGGAGTTCAT
ACTGTAAACA TCTAACCAAG CTTGTCTTCG TAACAATTTA TAATACTGCT GTCCATGGCG TCCCCTGTTT TGTAGTCAGT
GATCTGTTTC TTTCTTTCAG TCGTATCACT CTCTTTGTAT GGTGTCAAAA ATTATTTCTT TAATAAGATT TAATTATGCT
GAGCTTGTCC CCTTCATTAC TGATAAGATG CAGCCATTAT ATTTTCCAAC TCGCTCTAGT TCCATTAGTC ACTTGTTACT
GCTGCTAACT TAGAAATACC CTGTTGCATG TCACTTTCTC TGCTGTTAAA GGTCTTTAAA TAATAATTTC CAATTGATAT
GCTTTACAAG CTTGTTTTGT CAGCATTAAA TGATTTACAA ATGCCTAGTA TGGTCTTCCC ACTATAACTT TTCCTTGTTG
ATGTGATAGG TAATGCTTGG TGTTGACCGA CTTGACATGA TCAAAGGAAT TCCGCAAAAG ATTTTGGCCT TTGAAAAGTT
TCTCGAAGAA AACCATGAAT GGAATGATAA AGTGGTTCTA CTTCAAATTG CTGTGCCGAC AAGAACTGAT GTCCCTGAGT
GTATGAGCCC TTCCTGTGTT TTATCTCCTA TTTATACTTT GTGCGACTCT ACAAGCATGT CTGCTGGAGT ACCTCAGATG
CATGAAGTAT GACTTCTCCA TGTAAATGAA TTATCAATAT TTATCAGCTT GCAGTCTTCT TTCTTAAAAA AAAAACATTC
TTCTTAAAAT CTGAACGAAG TTGCAGTTCA ATAACTTTGT TATTGATTAT GGATTCAATA AGTCTTACTT GTGAGATCAT
ATTAGGTGAG AGTGGCTCAT ATTATCTACC TATCCATTTG AAAATGGGGC TGAAGTCCTA TAAGAACCTA GTTAGAAAGA
TTGTTTCTCA ACCTTATTTC CTAAGTTTGG TGTTATGTGA TTGAACTGGA AATCTAACCT GATTATTTGT GGTCATTTTA
ACTAACCTTA GAACATGTCA TGAGCAGATC AAAAGCTTAC AAGTCAGGTG CATGAAATTG TTGGGCGCAT AAATGGCCGA
TTTGGAACAC TGACTGCTGT TCCTATTCAT CATCTGGTTA GTTTTGTTTC TTGTCCTTGT TAACTTCATT TTTGCGCTAT
CACAAAAACA TACATCCTTC AGTCATATTT GCCTCTTCTC TAGTAGGTAA AATGGCACTT GTGATACCCA TATTTTCTAT
GATGACTATA CCTAACCTAT CACTATTTAA ATAATAAAAC AAGTCAGATT TTAGTTCCTT GTTTCACTCT ACCTTGAGCA
TATTTCATGC TTATTTTTTA TGAGAAGTTA TTGTATCATC TAAAAACATT GCACTCCTTG CAGGACCGAT CTCTTGATTT
CCATGCCTTG TGTGCCCTTT ATGCAGTCAC TGGTAATTAT AGGCTCCTCT TTTGATATTA AAATTTTACT CATGACAATA
ACTCCTGCTT TGTAATGATC ACATTTGAGT GTGTTGATAG GAATGTTCCT TCAGTATTTT AGTGACTCTT GCCAAGCTTG
ATCTGTGCAT TTCCTCTGTT TTCTTCAGAT GTGGCCCTTG TAACATCGCT GAGAGATGGA ATGAATCTTG TAAGCTATGA
ATATGTTGCA TGCCAAGGAT CAAAAAAAGG AGTTTTGATA TTGAGTGAGG TGAGCTGTCA GTTGTGATGA TCAATAACCT
TTGATCACTC CTGAATTTCC ATGCTATTCA TATCCATTCT GCTGGTTCAT ACTTTTCTAT TACTGTAATT TCAGTTTGCT
GGGGCAGCAC AGTCTCTTGG AGCCGGTGCT ATTTTAGTAA ACCCCTGGAA TATTACTGAA GTCGCAGACT CAATCAAGCA
TGCTTTGACA ATGTCATCTG ATGAGAGAGA AAAGCGACAT AGGCATAACT ATGCTCATGT GACAACTCAC ACTGCACAAG
ATTGGGCCGA AACTTTTGTA TGGTGAGTAG TTCATTCCAA TTGCCTGATC TGTAGAGCTT GTTTCCAATG GTCTGATTCG
TAGTCTGCTA GATTGGACCT TATTCGTTGA TTTGATGCTT GCTATTCGAC TGTACATTTT GTTTTCCCTT GTTTGACTGT
CTAAATATTG TGCTGCGTCT TTTCATGTAG TGAGTTAAAT GAGACAGTTG CTGAAGCTCA GCTGAGAACA AGACAAGTTC
CACCTGATCT CCCTAGTCAA GCAGCAATTC AACAATATCT GCATTCCAAA AATCGGTTGC TCATATTGGT ATTACCATAT
TTCTTCTTTG CTACCTTCTG TTGGCTGGGC TGTTCTGATG CAAAAATTGC TTGTTTATTC TTATCTTTTT TTGACGTAAA
TATTTATTCT TGTCTGATAG CAATTTCTTT ACATAGTTGC TTTGATTTGT GCTCTTATGC ACATATTGCC TTCACTCTGA
AATGATTGGC CTTAATCTTG CTGAAATAGT TGCTATGACT TATGCACCTT TTCTTGTTCA AGTAATTAAA TTTAAAATCT
ATAAAATTGA ACTATTTAAT TTAAATATTA CTGATTGTCC GATGATTTTT TTGGGAAGTC CAGTGAAAGC ATTTTTTTTT
TAAAAAAAAA CTCAGCTTTA GTTTATTTGT TTGGTTGCAC TTTCAAGTTT CAACCACTTT AAGTCGCATA CAAGTGATCT
GTTCAGCTTT CTCTTAAAAA AATAATAAAC TTAATTGCAC TTTGACAGTA GCATTTGTAT TTACCCTTTT TTTTTTACAA
TGTAGGGGTT CAATTCAACA TTGACTGAGC CAGTTGAATC CTCTGGGAGA AGGGGTGGTG ACCAAATCAA GGAAATGGAG
CTCAAGTTGC ATCCTGAGTT GAAGGGCCCT TTGAGAGCCC TCTGTGAGGA TGAGCATACT ACAGTTATTG TTCTTAGTGG
AAGTGACAGG AGCGTCCTTG ATGAAGTAAT TATCAGATTT TTCCTGTCTT TTTTCGTACA ATAGATTGAG TACGCTACTA
TATTTCCATC AAAACTAACA TATATCTTCC CATGCAGAAT TTCGGAGAAT TCAATATGTG GTTAGCAGCA GAGCATGGCA
TGTTTTTACG TCCAACTAAT GGAGAGTGGA TGACAACAAT GCCTGAGCAT CTGAACATGG ATTGGGTAGA CAGTGTAAAG
GTGTGTATTT GATAAATAAT GTCTGCTGCA ACCACTTGAT GAATGCCTTC TGACATTGTG TATTGCTTTC CAGAATGTTT
TTGAATACTT TACAGAAAGA ACCCCAAGGT CTCATTTTGA ACACCGTGAG ACATCATTTG TATGGAATTA CAAGTATGCT
GGTACGTGTT TATGCTTGAT TGCTCCTTTA GTTTTAATTA GAGAAGGCCT GCAATATAAA AGCTTAATGC TATTTTCGTT
TTCCCATTGC AAAGATGTTG AGTTTGGACG GCTCCAAGCA AGAGATATGC TGCAGCACTT GTGGACAGGT CCAATCTCAA
ATGCAGCAGT CGATGTTGTT CAAGGAAGCC GATCAGTTGA AGTTCGGTCT GTCGGAGTTA CAAAGGTCAG TGGTTCAGTG
TGATGCCTCA TGATAATTGA AAGTTTACAC TTTGTTGTTA GCGGATGTTT GAAAAATTAT GTTCTTTCCA CAGGGTGCTG
CAATTGATCG TATTCTAGGA GAGATAGTTC ATAGCAAAAG CATGATTACT CCAATTGATT ATGTTCTATG CATTGGGCAC
TTCCTAGGAA AGGTAATTAT GCAATTAATT TATATGTGCA TATCCGTTTC TTTCAGTGCA AGGTGCTTTT TTTGTCTTTG
ATGTTTCAAT TATCTCGTGT GGCGTGATGC GTGCAAATCT ATAAAGTTTG GATTGGTCTT ATATAGATGT TGTGACACTA
TTTCATTGGT TGTTTAGAAC AAAATCCAAA GTGGGGAGGA CACGTCCCCA AATAACCTCA TTAGCCCCTT GCAAATTTAT
ATGTGGAAGA AGTGGGATTT GTGGGAATGG GTATAAAAGT TTCTTTGGTA TCTTTCTTTC TTACACACGA AAAGAAGGGA
AAAATTACCT CCTAGCAAAG CACAAACCGT TCTTTTGGTT TACTTACGAA AATAATGTTT TAACTCAACA AAATTTAAGC
AATGTTCATA TCGTCAATGC TGTTGTACTG ATGCACAAAT AAAAGTTTTT TTGAGAATGT GCAAAAGAAT TGCACATCTT
TTGTATTAAG AATGAAGGAG AGTGGCAACA ACTTTACATC CTCTTTAGAA AACGAAAAGA AAAGGAGAAA ACACACAAAG
CACATTAGAG AGATATCTTG CATCATCCAT TTTGCGACCG AAGAGCACGA ATCCTCCTAC TCCGGCAACA GGCCGGCCTT
CCTCCAAAGG GTGGCTTTTT CAGCCACCGC TCTTGCTACC TCGTGCCACG ACCTTTGCTG TTGATTGAAC ACCCTATGGA
TATACAACAG TTTGAAATGT TTCGGAGTTA CCGAATTGAA ACTGCACAAG CTATTTACTC TAACATTGGA ACATGTAATA
ATTTTTGCCA TATAGCATGC ACGTTTCCTA CTATTCAATA CGAAGTTTGG AGCCTTTCGT GCTTTTAAAA CTGAAGGAAT
TGTCTTCTTT CTTGTGCATT CTTGTACTCT TCCTGCACTT GTTCGATTAA TCATTGGCTT TCTTTGGTAA CATTGTCTCT
TTTTCAGGAT GAGGACATCT ATGTCTTTTT CGATCCCGAG TACCCTTCTG AATCAAAAGT AAAACCAGAT AGCAGCGGCT
CGGTATCTCT TGACAGGAGG CCAAATGGAC GACCATCAAA CGGCAGGAGC AATTCCAGAA ACTCGCAGTC AAGGACACCC
AAGGCACAGG CTGCTCCGGA GAGGTCATCG TCATCATCTT CATCAAGCCA GGGCACCCCA AACAGCCACC ATGACTGGCG
CGAAGGGTCC TCGGTCCTTG ACCTCAAGGG CGAGAATTAT TTCTCCTGCG CTGTTGGAAG GAAGCGGTCC AACGCCCGCT
ACCTGCTTAA CTCGTCAGAG GAGGTCGTCT CCTTCCTCAA GGAGATGGCA GATGCAACGG CGGCTCACAA TGGGTTCCAG
TCCACAACTG CGGATTACAT GTTCTTGGAT AGGCAGTAG

Locus: Os05g0518600

Loading...

Locus: Os05g0518600

Loading...