Os05t0519400-01

Locus

Os05g0519400

Description

Homologue of NSF (N-ethylmaleimide sensitive factor), ATPase, Regulation of vacuolar morphology in endosperm cell

RAP-DB Gene Symbol Synonym(s)

OsSec18, Sec18

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSec18, Sec18, OsNSF, NSF

Oryzabase Gene Name Synonym(s)

N-ethylmaleimide-sensitive factor

Transcript Evidence

AK072976

Protein Evidence

Q65X08

Literature

PMID: 25848690

Note

Manual Curation

February 27, 2015

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Aspartate decarboxylase-like domain (IPR009010)

CDC48, N-terminal subdomain (IPR003338)

CDC48 domain 2-like (IPR029067)

CDC48, domain 2 (IPR004201)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

AAA+ ATPase domain (IPR003593)

ATPase, AAA-type, core (IPR003959)

ATPase, AAA-type, conserved site (IPR003960)

Full-length cDNA

J023146P19 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0519400-01)

RiceXPro (AK072976)

Others

Oryzabase (19544)

KEGG (Os05t0519400-01 (EC:3.6.4.6))

Transcript

2708 bp

>Os05t0519400-01 Homologue of NSF (N-ethylmaleimide sensitive factor), ATPase, Regulation of vacuolar morphology in endosperm cell
ACCATTTCCTTTCCTTTCGGCATCTCTCCTGCGCGGGCGAGTCGTCCTCCTCGTCCTCGT
CGTCCCCTTTCTCTGCTCCCGCGAGATCTCACCCCCGCTGCGGCGACGCGGCCATGGCGG
GGAGGAACTACCACGGCTACGGCGGCGGCGGCGGCGGGGGCATGTCCATGGTGGTGGCGA
GCACGCCGGGGCAGGAGCTGGCCCTCACCAACTGCGCGTACGTCTCCTccgccgacatcc
gccgcttccccaacgccctcgccctcgtcggcgacgccttcgtcttcaccctGCGTGCCC
ATGATGCTGTTTCTGCTGGAAGCATCGCATTGAATGCCATTCAGCGTCGCCAGACGAAGG
TTTCAGCTGGGGATTCAATCACTGTTAGCAGTTTTGCCCCTCCCGATGATTTCAAATTGG
CATTGCTCACATTAGAACTAGAGTATACCAAGGCAAGAACCAACCGAAATGAGGAGCTGG
ATGCTGTTGTGCTTGCCCAACAACTTCGAAGGAGATTTCTTGATCAGGTCATGACATCTG
GGCAAAGAGTACCATTTGAATTTTGTGGGACAAACTATATATTCACTGTCAATCAAGCTT
TGCTAGATGGCCAAGAAAATTCCACACCTTTGGACAGAGGATTCCTGTCAAGTGATACAT
ACATCATATTTGAGGCTGCGCCTAATTCAGGAATTAAGGTAGTAAACCAAAAGGAAGCTG
CTAGCAGCAAGCTTTTCAAGCACAAAGAGTTTAACCTTGAAAAGTTGGGGATAGGTGGAT
TAAGTGCTGAATTCACAGACATATTTAGAAGGGCATTTGCTTCAAGGGTGTTTCCTCCTC
ATGTTGTTAATAAATTGGGCATCAAGCATGTTAAAGGTATATTGCTGTATGGCCCCCCTG
GTACTGGCAAAACTCTTATGGCCCGTCAAATTGGGAAACTGCTGAACGGAAATGAACCCA
AGATTGTAAATGGACCTGAAGTCTTGAGCAAGTTTGTTGGAGAAACTGAGAAGAATGTGA
GAGATTTGTTCGCTGATGCTGAAAATGACCAGAAGACACGAGGTGATCAGAGTGACCTCC
ACGTTATCATTTTCGATGAAATTGATGCTATCTGCAAGTCTAGAGGATCTACCAGAGATG
GTACGGGTGTACATGATAGCATTGTAAATCAGCTCCTTACAAAGATAGATGGTGTTGAGG
CATTGAATAATGTGCTCCTCATTGGAATGACCAATCGTAAGGATTTACTTGATGAAGCTT
TACTGAGGCCTGGACGATTGGAAGTTCATATTGAGATAAACCTGCCTGATGAAAATGGCC
GTTTGCAGATTCTTCAAATTCATACGAATAAGATGAAAGAAAGCTCTTTCCTTTCCCCGA
ATGTTAATCTTCAGGAGCTAGCTGCACGGACAAAGAACTACAGTGGAGCAGAGCTGGAAG
GTGTCGTCAAAAGTGCAGTCTCATATGCTTTGAACAGGCAGATAAGCATGGATGACCTTA
CCAAGCCTTTGGATGAAGAAAGCATTAAGGTTACTATGGATGATTTTGTGAATGCACTTC
ATGAAATTACCCCTGCATTTGGTGCTTCCACTGATGACCTTGAAAGATGCAGGCTAAGGG
GTATGGTTGATTGTGGCAAGGCACATAGGCACTTGTATGAGAGAGGTATGCTTCTTGTTG
AGCAAGTTAAAGTTAGCAAAGGTAGTCCACTTGTGACATGCCTCTTGGAAGGTCCTGCTG
GAAGTGGTAAATCGGCTTTGGCTGCTACTGTTGGCATTGACAGTGATTTTGCTTACGTCA
AAATTATATCAGCAGAGACAATGATTGGTTTCAGTGAAAGCAGCAAATGTGCACAGATTT
GCAAGGTTTTTGAGGATGCATACAAATCTCAGTTTGGCATCATAATTCTAGATGACATCG
AAAGGTTACTGGAATATGTTGCCATTGGACCACGCTTTTCAAACATAATCTCACAAACTC
TACTAGTCCTTCTCAAGAGGGTTCCTCCTAAGGGCAAGAACTTGCTTGTTATTGGAACAA
CAAGTGAAGTAGGCTTTCTAGAATCCATTGGTATGTGCGACGTGTTCTCCGTGACATACC
ATGTCCCCAAACTGAAAAAGGAGGATGCTACAAAGGTGTTGCGGCATCTCAATGTGTTCG
ATGAAGCGGACATTGATGCGGCTGCAGAAGCACTGGACGATATGCCAATCAAGAAGCTGT
ACACACTCGTTGAGATGGCTGCACAAGGGCCATCAGGAGGAAGCGCGGAAGCAGTCTATG
GTGGAGAGGAAAAGATAGATATCAACCACTTCTTTAGCATCTTGAGTGATATTATCCGCT
ATTAACTACACGGCGTCGGAATGAACCCTAGGTGACACCATAGGAATTTAATTGCACATT
TCTTCTTACTTCAAGTTCTCCCTTTTGCCACCGTCGCCAGGGTATAGGGTTGTTTGATCT
TTGAGGTTCGTGTCTCCTTGTTGTGCCGCTTTGAGCTTTTGTTGGAATGTTGTTATGATT
CGGACAGAGGTTATACCTTACACGATGTAGCATGTTTCAACCGTATGTTTCGATACTTTC
CCAGCACAGAGTTGCACGAATATGATTTTGGGTGGCTCCTTTCCGGCTTTCCCTCTGTGT
TGTCTGTCTCGCTTGCTCTGTGCCTGTGTATGTGGCGGCCTGAACCAAACAAAAGAATCA
GCTTTGTT

CDS

2232 bp

>Os05t0519400-01 Homologue of NSF (N-ethylmaleimide sensitive factor), ATPase, Regulation of vacuolar morphology in endosperm cell
ATGGCGGGGAGGAACTACCACGGCTACGGCGGCGGCGGCGGCGGGGGCATGTCCATGGTG
GTGGCGAGCACGCCGGGGCAGGAGCTGGCCCTCACCAACTGCGCGTACGTCTCCTccgcc
gacatccgccgcttccccaacgccctcgccctcgtcggcgacgccttcgtcttcaccctG
CGTGCCCATGATGCTGTTTCTGCTGGAAGCATCGCATTGAATGCCATTCAGCGTCGCCAG
ACGAAGGTTTCAGCTGGGGATTCAATCACTGTTAGCAGTTTTGCCCCTCCCGATGATTTC
AAATTGGCATTGCTCACATTAGAACTAGAGTATACCAAGGCAAGAACCAACCGAAATGAG
GAGCTGGATGCTGTTGTGCTTGCCCAACAACTTCGAAGGAGATTTCTTGATCAGGTCATG
ACATCTGGGCAAAGAGTACCATTTGAATTTTGTGGGACAAACTATATATTCACTGTCAAT
CAAGCTTTGCTAGATGGCCAAGAAAATTCCACACCTTTGGACAGAGGATTCCTGTCAAGT
GATACATACATCATATTTGAGGCTGCGCCTAATTCAGGAATTAAGGTAGTAAACCAAAAG
GAAGCTGCTAGCAGCAAGCTTTTCAAGCACAAAGAGTTTAACCTTGAAAAGTTGGGGATA
GGTGGATTAAGTGCTGAATTCACAGACATATTTAGAAGGGCATTTGCTTCAAGGGTGTTT
CCTCCTCATGTTGTTAATAAATTGGGCATCAAGCATGTTAAAGGTATATTGCTGTATGGC
CCCCCTGGTACTGGCAAAACTCTTATGGCCCGTCAAATTGGGAAACTGCTGAACGGAAAT
GAACCCAAGATTGTAAATGGACCTGAAGTCTTGAGCAAGTTTGTTGGAGAAACTGAGAAG
AATGTGAGAGATTTGTTCGCTGATGCTGAAAATGACCAGAAGACACGAGGTGATCAGAGT
GACCTCCACGTTATCATTTTCGATGAAATTGATGCTATCTGCAAGTCTAGAGGATCTACC
AGAGATGGTACGGGTGTACATGATAGCATTGTAAATCAGCTCCTTACAAAGATAGATGGT
GTTGAGGCATTGAATAATGTGCTCCTCATTGGAATGACCAATCGTAAGGATTTACTTGAT
GAAGCTTTACTGAGGCCTGGACGATTGGAAGTTCATATTGAGATAAACCTGCCTGATGAA
AATGGCCGTTTGCAGATTCTTCAAATTCATACGAATAAGATGAAAGAAAGCTCTTTCCTT
TCCCCGAATGTTAATCTTCAGGAGCTAGCTGCACGGACAAAGAACTACAGTGGAGCAGAG
CTGGAAGGTGTCGTCAAAAGTGCAGTCTCATATGCTTTGAACAGGCAGATAAGCATGGAT
GACCTTACCAAGCCTTTGGATGAAGAAAGCATTAAGGTTACTATGGATGATTTTGTGAAT
GCACTTCATGAAATTACCCCTGCATTTGGTGCTTCCACTGATGACCTTGAAAGATGCAGG
CTAAGGGGTATGGTTGATTGTGGCAAGGCACATAGGCACTTGTATGAGAGAGGTATGCTT
CTTGTTGAGCAAGTTAAAGTTAGCAAAGGTAGTCCACTTGTGACATGCCTCTTGGAAGGT
CCTGCTGGAAGTGGTAAATCGGCTTTGGCTGCTACTGTTGGCATTGACAGTGATTTTGCT
TACGTCAAAATTATATCAGCAGAGACAATGATTGGTTTCAGTGAAAGCAGCAAATGTGCA
CAGATTTGCAAGGTTTTTGAGGATGCATACAAATCTCAGTTTGGCATCATAATTCTAGAT
GACATCGAAAGGTTACTGGAATATGTTGCCATTGGACCACGCTTTTCAAACATAATCTCA
CAAACTCTACTAGTCCTTCTCAAGAGGGTTCCTCCTAAGGGCAAGAACTTGCTTGTTATT
GGAACAACAAGTGAAGTAGGCTTTCTAGAATCCATTGGTATGTGCGACGTGTTCTCCGTG
ACATACCATGTCCCCAAACTGAAAAAGGAGGATGCTACAAAGGTGTTGCGGCATCTCAAT
GTGTTCGATGAAGCGGACATTGATGCGGCTGCAGAAGCACTGGACGATATGCCAATCAAG
AAGCTGTACACACTCGTTGAGATGGCTGCACAAGGGCCATCAGGAGGAAGCGCGGAAGCA
GTCTATGGTGGAGAGGAAAAGATAGATATCAACCACTTCTTTAGCATCTTGAGTGATATT
ATCCGCTATTAA

Protein

744 aa

>Os05t0519400-01 Homologue of NSF (N-ethylmaleimide sensitive factor), ATPase, Regulation of vacuolar morphology in endosperm cell
MAGRNYHGYGGGGGGGMSMVVASTPGQELALTNCAYVSSADIRRFPNALALVGDAFVFTL
RAHDAVSAGSIALNAIQRRQTKVSAGDSITVSSFAPPDDFKLALLTLELEYTKARTNRNE
ELDAVVLAQQLRRRFLDQVMTSGQRVPFEFCGTNYIFTVNQALLDGQENSTPLDRGFLSS
DTYIIFEAAPNSGIKVVNQKEAASSKLFKHKEFNLEKLGIGGLSAEFTDIFRRAFASRVF
PPHVVNKLGIKHVKGILLYGPPGTGKTLMARQIGKLLNGNEPKIVNGPEVLSKFVGETEK
NVRDLFADAENDQKTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDG
VEALNNVLLIGMTNRKDLLDEALLRPGRLEVHIEINLPDENGRLQILQIHTNKMKESSFL
SPNVNLQELAARTKNYSGAELEGVVKSAVSYALNRQISMDDLTKPLDEESIKVTMDDFVN
ALHEITPAFGASTDDLERCRLRGMVDCGKAHRHLYERGMLLVEQVKVSKGSPLVTCLLEG
PAGSGKSALAATVGIDSDFAYVKIISAETMIGFSESSKCAQICKVFEDAYKSQFGIIILD
DIERLLEYVAIGPRFSNIISQTLLVLLKRVPPKGKNLLVIGTTSEVGFLESIGMCDVFSV
TYHVPKLKKEDATKVLRHLNVFDEADIDAAAEALDDMPIKKLYTLVEMAAQGPSGGSAEA
VYGGEEKIDINHFFSILSDIIRY*

5'UTR

chr05:25788423..25788535 (- strand) : 113 bp

CDS

chr05:25788241..25788422 (- strand) : 182 bp

chr05:25787729..25787824 (- strand) : 96 bp

chr05:25787559..25787643 (- strand) : 85 bp

chr05:25787427..25787477 (- strand) : 51 bp

chr05:25787065..25787235 (- strand) : 171 bp

chr05:25786797..25786951 (- strand) : 155 bp

chr05:25786611..25786719 (- strand) : 109 bp

chr05:25785999..25786098 (- strand) : 100 bp

chr05:25785850..25785905 (- strand) : 56 bp

chr05:25785375..25785440 (- strand) : 66 bp

chr05:25785205..25785287 (- strand) : 83 bp

chr05:25784813..25784946 (- strand) : 134 bp

chr05:25784255..25784465 (- strand) : 211 bp

chr05:25783672..25783803 (- strand) : 132 bp

chr05:25783526..25783586 (- strand) : 61 bp

chr05:25783386..25783445 (- strand) : 60 bp

chr05:25783121..25783179 (- strand) : 59 bp

chr05:25782933..25783020 (- strand) : 88 bp

chr05:25782566..25782688 (- strand) : 123 bp

chr05:25782328..25782393 (- strand) : 66 bp

chr05:25782098..25782241 (- strand) : 144 bp

3'UTR

chr05:25781735..25782097 (- strand) : 363 bp

FASTA

>Os05t0519400-01 class=Sequence position=chr05:25781735..25788535 (- strand)
ACCATTTCCT TTCCTTTCGG CATCTCTCCT GCGCGGGCGA GTCGTCCTCC TCGTCCTCGT CGTCCCCTTT CTCTGCTCCC
GCGAGATCTC ACCCCCGCTG CGGCGACGCG GCCATGGCGG GGAGGAACTA CCACGGCTAC GGCGGCGGCG GCGGCGGGGG
CATGTCCATG GTGGTGGCGA GCACGCCGGG GCAGGAGCTG GCCCTCACCA ACTGCGCGTA CGTCTCCTcc gccgacatcc
gccgcttccc caacgccctc gccctcgtcg gcgacgcctt cgtcttcacc ctGCGATATC CTTTTGCCGA TCTCGTAACC
AAATCGGTTC GTGTGCTCTC CCCCGCGCTT AGATCTCTCT CCCCCCAAAT GAGCCCGTTC TGGCGATTTT GATCTGGTCT
GGTAGTGGTT CCCGTATGAA TCCACGAACG TAGAGAAAAC CAGTTGGTGA CTTGGTGTGA TGGTTAGTAG CGTGCCTAAG
CGCAAATGTT ATTGTGATTT GTTATCCTCC AGTGTTGATG TTTAGTTTAG TGTTCTGTGC TGGGGTTGCT GGGCTCACCG
TAATGTGGCT TCCAGTTATT ATTGCTCTCA AATCTACCTT CGATGAGATC ATGATGTCTC AGCTTTGAGA TGCTTTGATG
ATATTTCGTG CCTACTTCCC AATTGAATTA TAAGTTTCTC TTCTCATGTG TGATCCTTAA TGAATATCCA CTGCCCATGA
TGCTGTTTCT GCTGGAAGCA TCGCATTGAA TGCCATTCAG CGTCGCCAGA CGAAGGTTTC AGCTGGGGAT TCAATCACTG
TTAGCAGGTA GGAAGTTCAA GTGGCGTGCT GATCAATATT TTGAATGATT ATGTGTTGCC TTACTGTTTT CCCCTGATAA
TATTTGCATC AGTTTTGCCC CTCCCGATGA TTTCAAATTG GCATTGCTCA CATTAGAACT AGAGTATACC AAGGCAAGAA
CCAACCGAAA TGAGGAGGTA AGTTCGTTGT TCTGTTTATG ATGCAAATAT TTAGTGCTTG GTCAGTGTAA TCTCATCTGC
ATGAGCTTGG TTTCACAGCT GGATGCTGTT GTGCTTGCCC AACAACTTCG AAGGAGATTT CTTGATCAGG TATGCCATAG
TCAATTAACA TTGTTTCTCT GAGTAGGGTT TATTCCTTTG ATTCTTTCAG TCAATTGGAT TTAATGTGCA TGATATACAT
AAAATGTCTC ATTTGCACAA TTAGATTCTG GATTCATGTA AATTAACAGT ACTATGTCCT TGTATACCCT AAATGGTGAT
GATGGTGTTA TCTACAACAG GTCATGACAT CTGGGCAAAG AGTACCATTT GAATTTTGTG GGACAAACTA TATATTCACT
GTCAATCAAG CTTTGCTAGA TGGCCAAGAA AATTCCACAC CTTTGGACAG AGGATTCCTG TCAAGTGATA CATACATCAT
ATTTGAGGCT GCGCCTAATT CAGGAATTAA GGTTCATTTG AGTACCTTCT ATATTGTTGT CAGCTTCTTT TAATAGTGTA
TTTGACAAGA ACATTACTTA TAGCTTGTGA AACACCACAA ATAAGACCTA TTACTCTACT GCAGGTAGTA AACCAAAAGG
AAGCTGCTAG CAGCAAGCTT TTCAAGCACA AAGAGTTTAA CCTTGAAAAG TTGGGGATAG GTGGATTAAG TGCTGAATTC
ACAGACATAT TTAGAAGGGC ATTTGCTTCA AGGGTGTTTC CTCCTCATGT TGTTAATAAG TAAGAACAGT ATCTTCTCTA
TTTTTACTAT CATAAAAAAA AATAGATGAT GTGCTGCTAA TGGCTGAATA TTGCAGATTG GGCATCAAGC ATGTTAAAGG
TATATTGCTG TATGGCCCCC CTGGTACTGG CAAAACTCTT ATGGCCCGTC AAATTGGGAA ACTGCTGAAC GGAAATGAAC
CCAAGGTATG GTATGGAATC TATTATTGAA TATGGAGTAA AGTTTCTAGA TATTTGTTAA TGGCTTCCTT TGTATATTAC
CTATTTCTTT CTGATATGTA CTAGTAGGAT ACTCAAATCT GTACAAATAT TATATTTAAA AGTAGGGTTT CAAACGGTTT
AGTCACCAGC ACAGATATAC ATCGATAAGT GATAATATGC TATAACATTA TTTTAAAAGT AGACCTCAAA TTGTTGGATC
TTAAGTTATG TTATTTGGAA TACTAATCCA ATGAGGAAGC CCTCAAGTCT CGAAGGATTC AACCAGAGAA GCTCTGTGTC
ACACTCCATT TTATGCTGTG AAAGTGTCAT GAATTATAAA ACATTTTTTA TGAAATCGTT GTGTATCATG ACACAAATTT
ATGCAGTACA ACTTCCCAGA GTCAGTAATA TGTGATTGTT AAAAACTAGA AATCAAGAGC CCAGTAACCT ATGCAGATAG
CTCATACTTA ATGTTTAATA CCTTTCTACA AGCTCAGATT GTAAATGGAC CTGAAGTCTT GAGCAAGTTT GTTGGAGAAA
CTGAGAAGAA TGTGAGAGAT TTGTTCGCTG ATGCTGAAAA TGACCAGAAG ACACGAGGTA TGATTCCTCA TCGATAAAAG
CTTTTCCATA TTTTTATGTG GAGTGGACCC TTTTTAACAA TTAATCGCGG TACCTTGTTT TCAAATACAG GTGATCAGAG
TGACCTCCAC GTTATCATTT TCGATGAAAT TGATGCTATC TGCAAGGTGG AGTTCTTTTT CCTTAAATAA ACATCATGCA
TATTTCTACT TGACTATATC TTTCTCTCAA GATGTAAAAC ATCTTTTTTT GTGTTTCTTC CTTTGTTAAT TTCATAAGGT
TAGTTTGAGA ATGTCACCGA AGAGAATGGT TGAAGTACCC TTACATTAAG TGAGTTGGAA ATATGAGAGC AAATAGTTTG
ACTGATTAGT CATGCATAAG TTCTTAGGGA ATAACAGAGC ATAAGTACTT CAGATCAAAC TCTTTTACCC CTTCTAGAAG
TTCAACTTGC AATTTTGTCC AGTGTATATT TCAGTGTGCT ATGTTTGATT ACATCAGTTG TAGCATTGCT TCAGCTTTAT
TTATAGTAAC TGCTAACTTC TCCTGAATTA ATTAAACTCT GATTGTGCTG TGCAGTCTAG AGGATCTACC AGAGATGGTA
CGGGTGTACA TGATAGCATT GTAAATCAGC TCCTTACAAA GGTATCTTTT CCTAGAATTT GAACTTTGGA CTCACGTATT
TTCTTTCTGC ATATACACTA AGTTCTCGTC AAACTTTCTG CATTTTAGAT AGATGGTGTT GAGGCATTGA ATAATGTGCT
CCTCATTGGA ATGACCAATC GTAAGGATTT ACTTGATGAA GCTTTACTGA GGTAACTTCT GACCCTCTAG AAATGCACTC
AAGCTAGATC ATGAAATGCA TCAGACCTCC TAAAATTGTT ACCATTTCAT TTTATGTACA TTTTAATATC TAAACATAAC
TCTGTGCTGC ATTTACTGTG TAATTCAGAA AATTATGCTT GCCTTGATTA TTTTAGATAT TGCAGGCCTA AACCATTGGG
GAATCTTCTT TTTGTATTTT TGTTTTACTA TTTGCACGTA TCCATTGACA TTTGACACAT CTGTTACAGG CCTGGACGAT
TGGAAGTTCA TATTGAGATA AACCTGCCTG ATGAAAATGG CCGTTTGCAG ATTCTTCAAA TTCATACGAA TAAGATGAAA
GAAAGCTCTT TCCTTTCCCC GAATGTTAAT CTTCAGGAGC TAGGTATATT CTTTGATAAT TCATATTTGT TTTCAGGCAT
TCGTTCATTA TAACAAATGT TGTAAATGAT CTCTTAAAAT GGACTGATTA GCTCATTCTA GTCTTATTAC TCAAGCTTCA
AAGGTTTTAG TTTCCCATTT CCAAAAATTG CTGTCTTAGC AATGCTTCTT ACTTCAACAC CCATTTTAGT ATGACTGAGT
AGGTGCCTGT GGGAATTTCT TGTTCTAAAA GATATGTGCT GCATGTGATC TTGGCTGTGT ACATCCATGT TGGTTGTAGA
GGCTGGGTTT TAATCGATTA TCTACAAAAA TAATGTGATT GATGGTTGTG ACATGCTCTT CTGAATGAAG CTGCACGGAC
AAAGAACTAC AGTGGAGCAG AGCTGGAAGG TGTCGTCAAA AGTGCAGTCT CATATGCTTT GAACAGGCAG ATAAGCATGG
ATGACCTTAC CAAGCCTTTG GATGAAGAAA GCATTAAGGT TACTATGGAT GATTTTGTGA ATGCACTTCA TGAAATTACC
CCTGCATTTG GTGCTTCCAC TGATGACCTT GAAAGATGCA GGTCTGTGCT ATGATACCCC GAGCATTGCT TTAGCAAAAT
GTTTAATGAT CAGTTTCTTC TTAGGGTGTT TCTGGGCTCA TCTTTCAAAT TTATATTTTT TATTTTCCTG TGTCCCATGG
GACTATCTAA TTCTTATGCC GTTTGATACG GCACAATGCA ATTCCTAATT CATAGTCATT GTTGGCTATG GGCATGTCAT
TCTTGTGTAG TAGTTGATAG GGCTTTTTCC TTTGCATTAA TACATCTTTT TTATTAATGA TAACTCATGT CAATTTAATA
TTTTGCTAAA CAGATCACTT GGTTATTTAT CATAATTTAT TGTTTTGGAT GACCTAATGC ATTATGCCCT TTCATTCATT
AATTTCATGT GTTCTATTTA CTCTTTACTG TTTGTCTGAA TATTTGGTAG AAGTTTAATG CTATTTTCCA TACCTTTGTG
CAAAAATTAC AGGCTAAGGG GTATGGTTGA TTGTGGCAAG GCACATAGGC ACTTGTATGA GAGAGGTATG CTTCTTGTTG
AGCAAGTTAA AGTTAGCAAA GGTAGTCCAC TTGTGACATG CCTCTTGGAA GGTCCTGCTG GAAGGTATTG TAACTAACTA
AAACAGAATG TTCATCTTTA AAAACATTAC CAGAGCCTCA ATTCAATTAA CATTTCCTTT GCTTGTCAGT GGTAAATCGG
CTTTGGCTGC TACTGTTGGC ATTGACAGTG ATTTTGCTTA CGTCAAAATT GTAAGTTTCT TTCTGGATTT CCTTCATTTC
TCTATCAAAA GGTATATGTC TTATTTTTTT TTAATTTGTT TCCACTATAG ATATCAGCAG AGACAATGAT TGGTTTCAGT
GAAAGCAGCA AATGTGCACA GATTTGCAAG GTCAGATTTG ATGTATTACA TAATGCATTT AATTAGTGTG TGGAAGAGAC
ATTTGAAGGG TGTAGAAGTC TATATATTTT TCCTTTCTCT CTTAGCATCA TTTTATTTTG TAAAAGTACA TGTTTTTTTT
TCTGGCTATT TTGCTCGCCT TCTCTATATG TTCACAGAAT TATATTGAGG CAGTGTGTTT CGTCATTGCA ATACAGGTTT
TTGAGGATGC ATACAAATCT CAGTTTGGCA TCATAATTCT AGATGACATC GAAAGGTAGT TGACTAATCA AATCTGCAAA
CATTTTGTGC AATGCATCCT TTCTACATTC TGTTTTGGTT AATGTGTTCC TGTAATCACG TATAAAATCT TGTAGGTTAC
TGGAATATGT TGCCATTGGA CCACGCTTTT CAAACATAAT CTCACAAACT CTACTAGTCC TTCTCAAGAG GGTTCCTCCT
AAGGTTTGCA TGTTGCTGCT CTTCAGTATT ATCCTGAGCA TAATACTTGA TTACATCATC TAGAGGGTTC CTCCAAAGTC
CTAAGGTTTA CATAATCACA TTTGTTCTTT AGTAGCATCC TTCAGCGCAG TACATGGACT GTTTCACTTC TCGGACGTCG
GACATTGATG CTACACAGCT GTTGCCATTT CCCTTTTTTT TTTTTGAAGG AAACCACCTT TTTCCTCACC TGCTTTCTTC
TTTGCAGGGC AAGAACTTGC TTGTTATTGG AACAACAAGT GAAGTAGGCT TTCTAGAATC CATTGGTATG TGCGACGTGT
TCTCCGTGAC ATACCATGTC CCCAAACTGA AAAAGGAGGA TGCTACAAAG GTGAGAGGAT ACACAAGATA CTAGAATAAC
TGATATAAAC TGCATTCAAT TAATTGGCAA ATGACAGGGA TACTCATGTT CATGATGTGG AATACAAAAT CATTGATTTG
CTACCTTCTC CAGCACGTTA GACAATCATG TTTTCTTGAC TTGATTTTCC TTCTCGCTGT AGGTGTTGCG GCATCTCAAT
GTGTTCGATG AAGCGGACAT TGATGCGGCT GCAGAAGCAC TGGACGATGT AAATATTCTT TCTACTTGTT ATGTTATTAG
CTCTTTAATC AAAACCCTTC TGATCAAACT CTTTTAATCC TTCGGCTGAT GCAGATGCCA ATCAAGAAGC TGTACACACT
CGTTGAGATG GCTGCACAAG GGCCATCAGG AGGAAGCGCG GAAGCAGTCT ATGGTGGAGA GGAAAAGATA GATATCAACC
ACTTCTTTAG CATCTTGAGT GATATTATCC GCTATTAACT ACACGGCGTC GGAATGAACC CTAGGTGACA CCATAGGAAT
TTAATTGCAC ATTTCTTCTT ACTTCAAGTT CTCCCTTTTG CCACCGTCGC CAGGGTATAG GGTTGTTTGA TCTTTGAGGT
TCGTGTCTCC TTGTTGTGCC GCTTTGAGCT TTTGTTGGAA TGTTGTTATG ATTCGGACAG AGGTTATACC TTACACGATG
TAGCATGTTT CAACCGTATG TTTCGATACT TTCCCAGCAC AGAGTTGCAC GAATATGATT TTGGGTGGCT CCTTTCCGGC
TTTCCCTCTG TGTTGTCTGT CTCGCTTGCT CTGTGCCTGT GTATGTGGCG GCCTGAACCA AACAAAAGAA TCAGCTTTGT
T

Locus: Os05g0519400

Loading...

Locus: Os05g0519400

Loading...