Os05t0519400-02

Locus

Os05g0519400

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSec18, Sec18, OsNSF, NSF

Oryzabase Gene Name Synonym(s)

N-ethylmaleimide-sensitive factor

Transcript Evidence

AK058216 (DDBJ, Best hit)

Protein Evidence

Q40495 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ATPase, AAA+ type, core (IPR003593)

ATPase, AAA-type, core (IPR003959)

ATPase, AAA-type, conserved site (IPR003960)

Full-length cDNA

001-010-E10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0519400-02)

RiceXPro (AK058216)

Others

Oryzabase (19544)

KEGG (Os05t0519400-02 (EC:3.6.4.6))

Transcript

1461 bp

>Os05t0519400-02 Similar to predicted protein.
GTGACCTCCACGTTATCATTTTCGATGAAATTGATGCTATCTGCAAGTCTAGAGGATCTA
CCAGAGATGGTACGGGTGTACATGATAGCATTGTAAATCAGCTCCTTACAAAGATAGATG
GTGTTGAGGCATTGAATAATGTGCTCCTCATTGGAATGACCAATCGTAAGGATTTACTTG
ATGAAGCTTTACTGAGGCCTGGACGATTGGAAGTTCATATTGAGATAAACCTGCCTGATG
AAAATGGCCGTTTGCAGATTCTTCAAATTCATACGAATAAGATGAAAGAAAGCTCTTTCC
TTTCCCCGAATGTTAATCTTCAGGAGCTAGCTGCACGGACAAAGAACTACAGTGGAGCAG
AGCTGGAAGGTGTCGTCAAAAGTGCAGTCTCATATGCTTTGAACAGGCAGATAAGCATGG
ATGACCTTACCAAGCCTTTGGATGAAGAAAGCATTAAGGTTACTATGGATGATTTTGTGA
ATGCACTTCATGAAATTACCCCTGCATTTGGTGCTTCCACTGATGACCTTGAAAGATGCA
GGCTAAGGGGTATGGTTGATTGTGGCAAGGCACATAGGCACTTGTATGAGAGAGGTATGC
TTCTTGTTGAGCAAGTTAAAGTTAGCAAAGGTAGTCCACTTGTGACATGCCTCTTGGAAG
GTCCTGCTGGAAGTGGTAAATCGGCTTTGGCTGCTACTGTTGGCATTGACAGTGATTTTG
CTTACGTCAAAATTATATCAGCAGAGACAATGATTGGTTTCAGTGAAAGCAGCAAATGTG
CACAGATTTGCAAGGTTTTTGAGGATGCATACAAATCTCAGTTTGGCATCATAATTCTAG
ATGACATCGAAAGGTTACTGGAATATGTTGCCATTGGACCACGCTTTTCAAACATAATCT
CACAAACTCTACTAGTCCTTCTCAAGAGGGTTCCTCCTAAGGGCAAGAACTTGCTTGTTA
TTGGAACAACAAGTGAAGTAGGCTTTCTAGAATCCATTGGTATGTGCGACGTGTTCTCCG
TGACATACCATGTCCCCAAACTGAAAAAGGAGGATGCTACAAAGGTGTTGCGGCATCTCA
ATGTGTTCGATGAAGCGGACATTGATGCGGCTGCAGAAGCACTGGACGATATGCCAATCA
AGAAGCTGTACACACTCGTTGAGATGGCTGCACAAGGGCCATCAGGAGGAAGCGCGGAAG
CAGTCTATGGTGGAGAGGAAAAGATAGATATCAACCACTTCTTTAGCATCTTGAGTGATA
TTATCCGCTATTAACTACACGGCGTCGGAATGAACCCTAGGTGACACCATAGGAATTTAA
TTGCACATTTCTTCTTACTTCAAGTTCTCCCTTTTGCCACCGTCGCCAGGGTATAGGGTT
GTTTGATCTTTGAGGTTCGTGTCTCCTTGTTGTGCCGCTTTGAGCTTTTGTTGGAATGTT
GTTATGATTCGGACAGAGGTT

CDS

1272 bp

>Os05t0519400-02 Similar to predicted protein.
GACCTCCACGTTATCATTTTCGATGAAATTGATGCTATCTGCAAGTCTAGAGGATCTACC
AGAGATGGTACGGGTGTACATGATAGCATTGTAAATCAGCTCCTTACAAAGATAGATGGT
GTTGAGGCATTGAATAATGTGCTCCTCATTGGAATGACCAATCGTAAGGATTTACTTGAT
GAAGCTTTACTGAGGCCTGGACGATTGGAAGTTCATATTGAGATAAACCTGCCTGATGAA
AATGGCCGTTTGCAGATTCTTCAAATTCATACGAATAAGATGAAAGAAAGCTCTTTCCTT
TCCCCGAATGTTAATCTTCAGGAGCTAGCTGCACGGACAAAGAACTACAGTGGAGCAGAG
CTGGAAGGTGTCGTCAAAAGTGCAGTCTCATATGCTTTGAACAGGCAGATAAGCATGGAT
GACCTTACCAAGCCTTTGGATGAAGAAAGCATTAAGGTTACTATGGATGATTTTGTGAAT
GCACTTCATGAAATTACCCCTGCATTTGGTGCTTCCACTGATGACCTTGAAAGATGCAGG
CTAAGGGGTATGGTTGATTGTGGCAAGGCACATAGGCACTTGTATGAGAGAGGTATGCTT
CTTGTTGAGCAAGTTAAAGTTAGCAAAGGTAGTCCACTTGTGACATGCCTCTTGGAAGGT
CCTGCTGGAAGTGGTAAATCGGCTTTGGCTGCTACTGTTGGCATTGACAGTGATTTTGCT
TACGTCAAAATTATATCAGCAGAGACAATGATTGGTTTCAGTGAAAGCAGCAAATGTGCA
CAGATTTGCAAGGTTTTTGAGGATGCATACAAATCTCAGTTTGGCATCATAATTCTAGAT
GACATCGAAAGGTTACTGGAATATGTTGCCATTGGACCACGCTTTTCAAACATAATCTCA
CAAACTCTACTAGTCCTTCTCAAGAGGGTTCCTCCTAAGGGCAAGAACTTGCTTGTTATT
GGAACAACAAGTGAAGTAGGCTTTCTAGAATCCATTGGTATGTGCGACGTGTTCTCCGTG
ACATACCATGTCCCCAAACTGAAAAAGGAGGATGCTACAAAGGTGTTGCGGCATCTCAAT
GTGTTCGATGAAGCGGACATTGATGCGGCTGCAGAAGCACTGGACGATATGCCAATCAAG
AAGCTGTACACACTCGTTGAGATGGCTGCACAAGGGCCATCAGGAGGAAGCGCGGAAGCA
GTCTATGGTGGAGAGGAAAAGATAGATATCAACCACTTCTTTAGCATCTTGAGTGATATT
ATCCGCTATTAA

Protein

424 aa

>Os05t0519400-02 Similar to predicted protein.
DLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVEALNNVLLIGMTNRKDLLD
EALLRPGRLEVHIEINLPDENGRLQILQIHTNKMKESSFLSPNVNLQELAARTKNYSGAE
LEGVVKSAVSYALNRQISMDDLTKPLDEESIKVTMDDFVNALHEITPAFGASTDDLERCR
LRGMVDCGKAHRHLYERGMLLVEQVKVSKGSPLVTCLLEGPAGSGKSALAATVGIDSDFA
YVKIISAETMIGFSESSKCAQICKVFEDAYKSQFGIIILDDIERLLEYVAIGPRFSNIIS
QTLLVLLKRVPPKGKNLLVIGTTSEVGFLESIGMCDVFSVTYHVPKLKKEDATKVLRHLN
VFDEADIDAAAEALDDMPIKKLYTLVEMAAQGPSGGSAEAVYGGEEKIDINHFFSILSDI
IRY*

5'UTR

chr05:25785895..25785896 (- strand) : 2 bp

CDS

chr05:25785850..25785894 (- strand) : 45 bp

chr05:25785375..25785440 (- strand) : 66 bp

chr05:25785205..25785287 (- strand) : 83 bp

chr05:25784813..25784946 (- strand) : 134 bp

chr05:25784255..25784465 (- strand) : 211 bp

chr05:25783672..25783803 (- strand) : 132 bp

chr05:25783526..25783586 (- strand) : 61 bp

chr05:25783386..25783445 (- strand) : 60 bp

chr05:25783121..25783179 (- strand) : 59 bp

chr05:25782933..25783020 (- strand) : 88 bp

chr05:25782566..25782688 (- strand) : 123 bp

chr05:25782328..25782393 (- strand) : 66 bp

chr05:25782098..25782241 (- strand) : 144 bp

3'UTR

chr05:25781911..25782097 (- strand) : 187 bp

FASTA

>Os05t0519400-02 class=Sequence position=chr05:25781911..25785896 (- strand)
GTGACCTCCA CGTTATCATT TTCGATGAAA TTGATGCTAT CTGCAAGGTG GAGTTCTTTT TCCTTAAATA AACATCATGC
ATATTTCTAC TTGACTATAT CTTTCTCTCA AGATGTAAAA CATCTTTTTT TGTGTTTCTT CCTTTGTTAA TTTCATAAGG
TTAGTTTGAG AATGTCACCG AAGAGAATGG TTGAAGTACC CTTACATTAA GTGAGTTGGA AATATGAGAG CAAATAGTTT
GACTGATTAG TCATGCATAA GTTCTTAGGG AATAACAGAG CATAAGTACT TCAGATCAAA CTCTTTTACC CCTTCTAGAA
GTTCAACTTG CAATTTTGTC CAGTGTATAT TTCAGTGTGC TATGTTTGAT TACATCAGTT GTAGCATTGC TTCAGCTTTA
TTTATAGTAA CTGCTAACTT CTCCTGAATT AATTAAACTC TGATTGTGCT GTGCAGTCTA GAGGATCTAC CAGAGATGGT
ACGGGTGTAC ATGATAGCAT TGTAAATCAG CTCCTTACAA AGGTATCTTT TCCTAGAATT TGAACTTTGG ACTCACGTAT
TTTCTTTCTG CATATACACT AAGTTCTCGT CAAACTTTCT GCATTTTAGA TAGATGGTGT TGAGGCATTG AATAATGTGC
TCCTCATTGG AATGACCAAT CGTAAGGATT TACTTGATGA AGCTTTACTG AGGTAACTTC TGACCCTCTA GAAATGCACT
CAAGCTAGAT CATGAAATGC ATCAGACCTC CTAAAATTGT TACCATTTCA TTTTATGTAC ATTTTAATAT CTAAACATAA
CTCTGTGCTG CATTTACTGT GTAATTCAGA AAATTATGCT TGCCTTGATT ATTTTAGATA TTGCAGGCCT AAACCATTGG
GGAATCTTCT TTTTGTATTT TTGTTTTACT ATTTGCACGT ATCCATTGAC ATTTGACACA TCTGTTACAG GCCTGGACGA
TTGGAAGTTC ATATTGAGAT AAACCTGCCT GATGAAAATG GCCGTTTGCA GATTCTTCAA ATTCATACGA ATAAGATGAA
AGAAAGCTCT TTCCTTTCCC CGAATGTTAA TCTTCAGGAG CTAGGTATAT TCTTTGATAA TTCATATTTG TTTTCAGGCA
TTCGTTCATT ATAACAAATG TTGTAAATGA TCTCTTAAAA TGGACTGATT AGCTCATTCT AGTCTTATTA CTCAAGCTTC
AAAGGTTTTA GTTTCCCATT TCCAAAAATT GCTGTCTTAG CAATGCTTCT TACTTCAACA CCCATTTTAG TATGACTGAG
TAGGTGCCTG TGGGAATTTC TTGTTCTAAA AGATATGTGC TGCATGTGAT CTTGGCTGTG TACATCCATG TTGGTTGTAG
AGGCTGGGTT TTAATCGATT ATCTACAAAA ATAATGTGAT TGATGGTTGT GACATGCTCT TCTGAATGAA GCTGCACGGA
CAAAGAACTA CAGTGGAGCA GAGCTGGAAG GTGTCGTCAA AAGTGCAGTC TCATATGCTT TGAACAGGCA GATAAGCATG
GATGACCTTA CCAAGCCTTT GGATGAAGAA AGCATTAAGG TTACTATGGA TGATTTTGTG AATGCACTTC ATGAAATTAC
CCCTGCATTT GGTGCTTCCA CTGATGACCT TGAAAGATGC AGGTCTGTGC TATGATACCC CGAGCATTGC TTTAGCAAAA
TGTTTAATGA TCAGTTTCTT CTTAGGGTGT TTCTGGGCTC ATCTTTCAAA TTTATATTTT TTATTTTCCT GTGTCCCATG
GGACTATCTA ATTCTTATGC CGTTTGATAC GGCACAATGC AATTCCTAAT TCATAGTCAT TGTTGGCTAT GGGCATGTCA
TTCTTGTGTA GTAGTTGATA GGGCTTTTTC CTTTGCATTA ATACATCTTT TTTATTAATG ATAACTCATG TCAATTTAAT
ATTTTGCTAA ACAGATCACT TGGTTATTTA TCATAATTTA TTGTTTTGGA TGACCTAATG CATTATGCCC TTTCATTCAT
TAATTTCATG TGTTCTATTT ACTCTTTACT GTTTGTCTGA ATATTTGGTA GAAGTTTAAT GCTATTTTCC ATACCTTTGT
GCAAAAATTA CAGGCTAAGG GGTATGGTTG ATTGTGGCAA GGCACATAGG CACTTGTATG AGAGAGGTAT GCTTCTTGTT
GAGCAAGTTA AAGTTAGCAA AGGTAGTCCA CTTGTGACAT GCCTCTTGGA AGGTCCTGCT GGAAGGTATT GTAACTAACT
AAAACAGAAT GTTCATCTTT AAAAACATTA CCAGAGCCTC AATTCAATTA ACATTTCCTT TGCTTGTCAG TGGTAAATCG
GCTTTGGCTG CTACTGTTGG CATTGACAGT GATTTTGCTT ACGTCAAAAT TGTAAGTTTC TTTCTGGATT TCCTTCATTT
CTCTATCAAA AGGTATATGT CTTATTTTTT TTTAATTTGT TTCCACTATA GATATCAGCA GAGACAATGA TTGGTTTCAG
TGAAAGCAGC AAATGTGCAC AGATTTGCAA GGTCAGATTT GATGTATTAC ATAATGCATT TAATTAGTGT GTGGAAGAGA
CATTTGAAGG GTGTAGAAGT CTATATATTT TTCCTTTCTC TCTTAGCATC ATTTTATTTT GTAAAAGTAC ATGTTTTTTT
TTCTGGCTAT TTTGCTCGCC TTCTCTATAT GTTCACAGAA TTATATTGAG GCAGTGTGTT TCGTCATTGC AATACAGGTT
TTTGAGGATG CATACAAATC TCAGTTTGGC ATCATAATTC TAGATGACAT CGAAAGGTAG TTGACTAATC AAATCTGCAA
ACATTTTGTG CAATGCATCC TTTCTACATT CTGTTTTGGT TAATGTGTTC CTGTAATCAC GTATAAAATC TTGTAGGTTA
CTGGAATATG TTGCCATTGG ACCACGCTTT TCAAACATAA TCTCACAAAC TCTACTAGTC CTTCTCAAGA GGGTTCCTCC
TAAGGTTTGC ATGTTGCTGC TCTTCAGTAT TATCCTGAGC ATAATACTTG ATTACATCAT CTAGAGGGTT CCTCCAAAGT
CCTAAGGTTT ACATAATCAC ATTTGTTCTT TAGTAGCATC CTTCAGCGCA GTACATGGAC TGTTTCACTT CTCGGACGTC
GGACATTGAT GCTACACAGC TGTTGCCATT TCCCTTTTTT TTTTTTGAAG GAAACCACCT TTTTCCTCAC CTGCTTTCTT
CTTTGCAGGG CAAGAACTTG CTTGTTATTG GAACAACAAG TGAAGTAGGC TTTCTAGAAT CCATTGGTAT GTGCGACGTG
TTCTCCGTGA CATACCATGT CCCCAAACTG AAAAAGGAGG ATGCTACAAA GGTGAGAGGA TACACAAGAT ACTAGAATAA
CTGATATAAA CTGCATTCAA TTAATTGGCA AATGACAGGG ATACTCATGT TCATGATGTG GAATACAAAA TCATTGATTT
GCTACCTTCT CCAGCACGTT AGACAATCAT GTTTTCTTGA CTTGATTTTC CTTCTCGCTG TAGGTGTTGC GGCATCTCAA
TGTGTTCGAT GAAGCGGACA TTGATGCGGC TGCAGAAGCA CTGGACGATG TAAATATTCT TTCTACTTGT TATGTTATTA
GCTCTTTAAT CAAAACCCTT CTGATCAAAC TCTTTTAATC CTTCGGCTGA TGCAGATGCC AATCAAGAAG CTGTACACAC
TCGTTGAGAT GGCTGCACAA GGGCCATCAG GAGGAAGCGC GGAAGCAGTC TATGGTGGAG AGGAAAAGAT AGATATCAAC
CACTTCTTTA GCATCTTGAG TGATATTATC CGCTATTAAC TACACGGCGT CGGAATGAAC CCTAGGTGAC ACCATAGGAA
TTTAATTGCA CATTTCTTCT TACTTCAAGT TCTCCCTTTT GCCACCGTCG CCAGGGTATA GGGTTGTTTG ATCTTTGAGG
TTCGTGTCTC CTTGTTGTGC CGCTTTGAGC TTTTGTTGGA ATGTTGTTAT GATTCGGACA GAGGTT

Locus: Os05g0519400

Loading...

Locus: Os05g0519400

Loading...