Os05t0519400-03

Locus

Os05g0519400

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSec18, Sec18, OsNSF, NSF

Oryzabase Gene Name Synonym(s)

N-ethylmaleimide-sensitive factor

Transcript Evidence

AK102296 (DDBJ, Best hit)

Protein Evidence

Q40495 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ATPase, AAA+ type, core (IPR003593)

ATPase, AAA-type, core (IPR003959)

Full-length cDNA

J033089L09 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0519400-03)

RiceXPro (AK102296)

Others

Oryzabase (19544)

KEGG (Os05t0519400-03 (EC:3.6.4.6))

Transcript

1236 bp

>Os05t0519400-03 Similar to predicted protein.
GCTCTTTCCTTTCCCCGAATGTTAATCTTCAGGAGCTAGCTGCACGGACAAAGAACTACA
GTGGAGCAGAGCTGGAAGGTGTCGTCAAAAGTGCAGTCTCATATGCTTTGAACAGGCAGA
TAAGCATGGATGACCTTACCAAGCCTTTGGATGAAGAAAGCATTAAGGTTACTATGGATG
ATTTTGTGAATGCACTTCATGAAATTACCCCTGCATTTGGTGCTTCCACTGATGACCTTG
AAAGATGCAGGCTAAGGGGTATGGTTGATTGTGGCAAGGCACATAGGCACTTGTATGAGA
GAGGTATGCTTCTTGTTGAGCAAGTTAAAGTTAGCAAAGGTAGTCCACTTGTGACATGCC
TCTTGGAAGGTCCTGCTGGAAGTGGTAAATCGGCTTTGGCTGCTACTGTTGGCATTGACA
GTGATTTTGCTTACGTCAAAATTATATCAGCAGAGACAATGATTGGTTTCAGTGAAAGCA
GCAAATGTGCACAGATTTGCAAGGTTTTTGAGGATGCATACAAATCTCAGTTTGGCATCA
TAATTCTAGATGACATCGAAAGGTTACTGGAATATGTTGCCATTGGACCACGCTTTTCAA
ACATAATCTCACAAACTCTACTAGTCCTTCTCAAGAGGGTTCCTCCTAAGGGCAAGAACT
TGCTTGTTATTGGAACAACAAGTGAAGTAGGCTTTCTAGAATCCATTGGTATGTGCGACG
TGTTCTCCGTGACATACCATGTCCCCAAACTGAAAAAGGAGGATGCTACAAAGGTGTTGC
GGCATCTCAATGTGTTCGATGAAGCGGACATTGATGCGGCTGCAGAAGCACTGGACGATA
TGCCAATCAAGAAGCTGTACACACTCGTTGAGATGGCTGCACAAGGGCCATCAGGAGGAA
GCGCGGAAGCAGTCTATGGTGGAGAGGAAAAGATAGATATCAACCACTTCTTTAGCATCT
TGAGTGATATTATCCGCTATTAACTACACGGCGTCGGAATGAACCCTAGGTGACACCATA
GGAATTTAATTGCACATTTCTTCTTACTTCAAGTTCTCCCTTTTGCCACCGTCGCCAGGG
TATAGGGTTGTTTGATCTTTGAGGTTCGTGTCTCCTTGTTGTGCCGCTTTGAGCTTTTGT
TGGAATGTTGTTATGATTCGGACAGAGGTTATACCTTACACGATGTAGCATGTTTCAACC
GTATGTTTCGATACTTTCCCAGCACAGAGTTGCACG

CDS

981 bp

>Os05t0519400-03 Similar to predicted protein.
TCTTTCCTTTCCCCGAATGTTAATCTTCAGGAGCTAGCTGCACGGACAAAGAACTACAGT
GGAGCAGAGCTGGAAGGTGTCGTCAAAAGTGCAGTCTCATATGCTTTGAACAGGCAGATA
AGCATGGATGACCTTACCAAGCCTTTGGATGAAGAAAGCATTAAGGTTACTATGGATGAT
TTTGTGAATGCACTTCATGAAATTACCCCTGCATTTGGTGCTTCCACTGATGACCTTGAA
AGATGCAGGCTAAGGGGTATGGTTGATTGTGGCAAGGCACATAGGCACTTGTATGAGAGA
GGTATGCTTCTTGTTGAGCAAGTTAAAGTTAGCAAAGGTAGTCCACTTGTGACATGCCTC
TTGGAAGGTCCTGCTGGAAGTGGTAAATCGGCTTTGGCTGCTACTGTTGGCATTGACAGT
GATTTTGCTTACGTCAAAATTATATCAGCAGAGACAATGATTGGTTTCAGTGAAAGCAGC
AAATGTGCACAGATTTGCAAGGTTTTTGAGGATGCATACAAATCTCAGTTTGGCATCATA
ATTCTAGATGACATCGAAAGGTTACTGGAATATGTTGCCATTGGACCACGCTTTTCAAAC
ATAATCTCACAAACTCTACTAGTCCTTCTCAAGAGGGTTCCTCCTAAGGGCAAGAACTTG
CTTGTTATTGGAACAACAAGTGAAGTAGGCTTTCTAGAATCCATTGGTATGTGCGACGTG
TTCTCCGTGACATACCATGTCCCCAAACTGAAAAAGGAGGATGCTACAAAGGTGTTGCGG
CATCTCAATGTGTTCGATGAAGCGGACATTGATGCGGCTGCAGAAGCACTGGACGATATG
CCAATCAAGAAGCTGTACACACTCGTTGAGATGGCTGCACAAGGGCCATCAGGAGGAAGC
GCGGAAGCAGTCTATGGTGGAGAGGAAAAGATAGATATCAACCACTTCTTTAGCATCTTG
AGTGATATTATCCGCTATTAA

Protein

327 aa

>Os05t0519400-03 Similar to predicted protein.
SFLSPNVNLQELAARTKNYSGAELEGVVKSAVSYALNRQISMDDLTKPLDEESIKVTMDD
FVNALHEITPAFGASTDDLERCRLRGMVDCGKAHRHLYERGMLLVEQVKVSKGSPLVTCL
LEGPAGSGKSALAATVGIDSDFAYVKIISAETMIGFSESSKCAQICKVFEDAYKSQFGII
ILDDIERLLEYVAIGPRFSNIISQTLLVLLKRVPPKGKNLLVIGTTSEVGFLESIGMCDV
FSVTYHVPKLKKEDATKVLRHLNVFDEADIDAAAEALDDMPIKKLYTLVEMAAQGPSGGS
AEAVYGGEEKIDINHFFSILSDIIRY*

5'UTR

chr05:25784850..25784851 (- strand) : 2 bp

CDS

chr05:25784813..25784849 (- strand) : 37 bp

chr05:25784255..25784465 (- strand) : 211 bp

chr05:25783672..25783803 (- strand) : 132 bp

chr05:25783526..25783586 (- strand) : 61 bp

chr05:25783386..25783445 (- strand) : 60 bp

chr05:25783121..25783179 (- strand) : 59 bp

chr05:25782933..25783020 (- strand) : 88 bp

chr05:25782566..25782688 (- strand) : 123 bp

chr05:25782328..25782393 (- strand) : 66 bp

chr05:25782098..25782241 (- strand) : 144 bp

3'UTR

chr05:25781845..25782097 (- strand) : 253 bp

FASTA

>Os05t0519400-03 class=Sequence position=chr05:25781845..25784851 (- strand)
GCTCTTTCCT TTCCCCGAAT GTTAATCTTC AGGAGCTAGG TATATTCTTT GATAATTCAT ATTTGTTTTC AGGCATTCGT
TCATTATAAC AAATGTTGTA AATGATCTCT TAAAATGGAC TGATTAGCTC ATTCTAGTCT TATTACTCAA GCTTCAAAGG
TTTTAGTTTC CCATTTCCAA AAATTGCTGT CTTAGCAATG CTTCTTACTT CAACACCCAT TTTAGTATGA CTGAGTAGGT
GCCTGTGGGA ATTTCTTGTT CTAAAAGATA TGTGCTGCAT GTGATCTTGG CTGTGTACAT CCATGTTGGT TGTAGAGGCT
GGGTTTTAAT CGATTATCTA CAAAAATAAT GTGATTGATG GTTGTGACAT GCTCTTCTGA ATGAAGCTGC ACGGACAAAG
AACTACAGTG GAGCAGAGCT GGAAGGTGTC GTCAAAAGTG CAGTCTCATA TGCTTTGAAC AGGCAGATAA GCATGGATGA
CCTTACCAAG CCTTTGGATG AAGAAAGCAT TAAGGTTACT ATGGATGATT TTGTGAATGC ACTTCATGAA ATTACCCCTG
CATTTGGTGC TTCCACTGAT GACCTTGAAA GATGCAGGTC TGTGCTATGA TACCCCGAGC ATTGCTTTAG CAAAATGTTT
AATGATCAGT TTCTTCTTAG GGTGTTTCTG GGCTCATCTT TCAAATTTAT ATTTTTTATT TTCCTGTGTC CCATGGGACT
ATCTAATTCT TATGCCGTTT GATACGGCAC AATGCAATTC CTAATTCATA GTCATTGTTG GCTATGGGCA TGTCATTCTT
GTGTAGTAGT TGATAGGGCT TTTTCCTTTG CATTAATACA TCTTTTTTAT TAATGATAAC TCATGTCAAT TTAATATTTT
GCTAAACAGA TCACTTGGTT ATTTATCATA ATTTATTGTT TTGGATGACC TAATGCATTA TGCCCTTTCA TTCATTAATT
TCATGTGTTC TATTTACTCT TTACTGTTTG TCTGAATATT TGGTAGAAGT TTAATGCTAT TTTCCATACC TTTGTGCAAA
AATTACAGGC TAAGGGGTAT GGTTGATTGT GGCAAGGCAC ATAGGCACTT GTATGAGAGA GGTATGCTTC TTGTTGAGCA
AGTTAAAGTT AGCAAAGGTA GTCCACTTGT GACATGCCTC TTGGAAGGTC CTGCTGGAAG GTATTGTAAC TAACTAAAAC
AGAATGTTCA TCTTTAAAAA CATTACCAGA GCCTCAATTC AATTAACATT TCCTTTGCTT GTCAGTGGTA AATCGGCTTT
GGCTGCTACT GTTGGCATTG ACAGTGATTT TGCTTACGTC AAAATTGTAA GTTTCTTTCT GGATTTCCTT CATTTCTCTA
TCAAAAGGTA TATGTCTTAT TTTTTTTTAA TTTGTTTCCA CTATAGATAT CAGCAGAGAC AATGATTGGT TTCAGTGAAA
GCAGCAAATG TGCACAGATT TGCAAGGTCA GATTTGATGT ATTACATAAT GCATTTAATT AGTGTGTGGA AGAGACATTT
GAAGGGTGTA GAAGTCTATA TATTTTTCCT TTCTCTCTTA GCATCATTTT ATTTTGTAAA AGTACATGTT TTTTTTTCTG
GCTATTTTGC TCGCCTTCTC TATATGTTCA CAGAATTATA TTGAGGCAGT GTGTTTCGTC ATTGCAATAC AGGTTTTTGA
GGATGCATAC AAATCTCAGT TTGGCATCAT AATTCTAGAT GACATCGAAA GGTAGTTGAC TAATCAAATC TGCAAACATT
TTGTGCAATG CATCCTTTCT ACATTCTGTT TTGGTTAATG TGTTCCTGTA ATCACGTATA AAATCTTGTA GGTTACTGGA
ATATGTTGCC ATTGGACCAC GCTTTTCAAA CATAATCTCA CAAACTCTAC TAGTCCTTCT CAAGAGGGTT CCTCCTAAGG
TTTGCATGTT GCTGCTCTTC AGTATTATCC TGAGCATAAT ACTTGATTAC ATCATCTAGA GGGTTCCTCC AAAGTCCTAA
GGTTTACATA ATCACATTTG TTCTTTAGTA GCATCCTTCA GCGCAGTACA TGGACTGTTT CACTTCTCGG ACGTCGGACA
TTGATGCTAC ACAGCTGTTG CCATTTCCCT TTTTTTTTTT TGAAGGAAAC CACCTTTTTC CTCACCTGCT TTCTTCTTTG
CAGGGCAAGA ACTTGCTTGT TATTGGAACA ACAAGTGAAG TAGGCTTTCT AGAATCCATT GGTATGTGCG ACGTGTTCTC
CGTGACATAC CATGTCCCCA AACTGAAAAA GGAGGATGCT ACAAAGGTGA GAGGATACAC AAGATACTAG AATAACTGAT
ATAAACTGCA TTCAATTAAT TGGCAAATGA CAGGGATACT CATGTTCATG ATGTGGAATA CAAAATCATT GATTTGCTAC
CTTCTCCAGC ACGTTAGACA ATCATGTTTT CTTGACTTGA TTTTCCTTCT CGCTGTAGGT GTTGCGGCAT CTCAATGTGT
TCGATGAAGC GGACATTGAT GCGGCTGCAG AAGCACTGGA CGATGTAAAT ATTCTTTCTA CTTGTTATGT TATTAGCTCT
TTAATCAAAA CCCTTCTGAT CAAACTCTTT TAATCCTTCG GCTGATGCAG ATGCCAATCA AGAAGCTGTA CACACTCGTT
GAGATGGCTG CACAAGGGCC ATCAGGAGGA AGCGCGGAAG CAGTCTATGG TGGAGAGGAA AAGATAGATA TCAACCACTT
CTTTAGCATC TTGAGTGATA TTATCCGCTA TTAACTACAC GGCGTCGGAA TGAACCCTAG GTGACACCAT AGGAATTTAA
TTGCACATTT CTTCTTACTT CAAGTTCTCC CTTTTGCCAC CGTCGCCAGG GTATAGGGTT GTTTGATCTT TGAGGTTCGT
GTCTCCTTGT TGTGCCGCTT TGAGCTTTTG TTGGAATGTT GTTATGATTC GGACAGAGGT TATACCTTAC ACGATGTAGC
ATGTTTCAAC CGTATGTTTC GATACTTTCC CAGCACAGAG TTGCACG

Locus: Os05g0519400

Loading...

Locus: Os05g0519400

Loading...