Os05t0519500-02

Locus

Os05g0519500

Description

WD40/YVTN repeat-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-120

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK111856 (DDBJ, Best hit)

Protein Evidence

E6NUE1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

Small-subunit processome, Utp12 (IPR007148)

Six-bladed beta-propeller, TolB-like (IPR011042)

WD40 repeat-like-containing domain (IPR011046)

Quinonprotein alcohol dehydrogenase-like (IPR011047)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

G-protein beta WD-40 repeat (IPR020472)

Full-length cDNA

J033022A22 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0519500-02)

RiceXPro (AK111856)

Others

Oryzabase (10801)

KEGG (Os05t0519500-02)

Transcript

3046 bp

>Os05t0519500-02 WD40/YVTN repeat-like domain containing protein.
ATGAACTACCGCTTCCACAACCTCCTGGGCGCGCCGTACCGCGGCGGCGACGCCGTCTTC
GCCGGTGACTCCTCCGTCCTCCTCTCCGCCGTCGGCAACCGCGTCGCGTCCACCGACCTC
TCCGCCTCCTCCTCCCTCACGCTCCCCTTCGAGTCCTCCTCCAACGTCACCCGCCTCGCC
GTCTCCCCCTCGGGCGACTTCCTCCTCTCCGTCGACGACGCCGGCCGCGCGCTCTACGCC
AACCTCGGCCGCCGCGCCGTCCTCCACCGGATCGCCTTCAAGTCCGCCCCCTCCGCCGTC
CGCTTCAGCCCCGACGGCAACCTCATCGCCGTCGCCGTCGGTAAGCTCGTCCAGATCTGG
CGCTCGCCCGCGTTCCGCAAGGAGTTCTTCCCTTTCCACCTGCTCCGCACCATCCCTGGC
TTCGCCGCCGGTGTCACCGCCTTCGACTGGTCTCCCGACTCCTCGTTCCTCCTCGCCTCC
TGCAAGGACCTCACCGCCCGCCTCTTGCCTGTCAAGAAAGGCCTTGGAGGCAAACCATTC
CTCTTCGTTGGCCACCGCGCCGCCGTGGTTGGCGCCTTCTTCGCCACAGATAAGAAGACA
GGGAGAGTCACTGGGGCTTACACAATTACCAAGGACGGAGCTATCTTTACATGGAATTTG
GTGGAAGGAAGTGATGATTCGCCTCCACCTTCACCAGGGACGCCAGAGCAGGAGGCGGTA
CAGGATGGTGAGGCTGAATTGGACGGTGACGAGCCCGAATTGGATGGCGGGAGCAGGAAA
AGGAAGAGTTTCGGAGAATCGGAAGAACCAGACACTACCCCGCTGCATTTCACAAGGTGG
GAGCTGCAGAAAAAGGACTTCTTCATGCAGTCACCGGCTAAGTTAACAGCCTGTGATTAC
CATAGGGAGCTTGACATGGTGGTGGTTGGTTTCTCTAATGGTGTATTTGGGCTGTACCAG
ATGCCAGACTTTGTGTGCCTCCACTTACTGTCAATATCAAGGGAGAAGATCACTACTGCT
ATTTTCAACAGTTTGGGGAATTGGTTAGTTTTTGGATGTGCCAAACTTGGGCAATTACTG
GTGTGGGAGTGGCGATCAGAGAGCTACATTTTGAAGCAGCAGGGGCACTACTTTGATGTG
AACTGCATTGCATACTCACCAGACTCCCAATTACTGGCCACTGGAGCTGATGATAACAAA
GTCAAGGTCTGGACAGTCTCCTCTGGGTTCTGTTTCATAACATTTTCGGAGCATACAAAC
GCTGTTACTGCAGTTCATTTTATGGCCAATAATCATTCTCTTCTCAGTGCCTCCCTTGAT
GGGACTATTCGAGCATGGGATCTGTTCCGCTATCGAAATTTCAAGACATTTACTACTGCA
TTGCCCAGACAATTTGTTTCTTTAACGGCAGATCAGAGTGGAGAAGTAATATGTGCTGGA
ACACTTGATTCATTTGAGATATTTGTTTGGTCAATGAAGACTGGTCGTTTGTTGGATATA
CTCAGTGGTCACCAAGGACCAGTTCATGGCCTAATGTTTTCGCCAATCAATGCTATTTTG
GCTTCATCATCATGGGACAAAACAGTTCGCCTTTGGGACGTATTTGAGAGCAAGGGTGCA
GTGGAAACTTTTCAACATTCACATGATGTTCTTACTTTGGCTTATCGCCCTGATGGAAGA
CAGATAGCATGCAGCACACTAGATGGCTTAATCCATTTCTGGGATCCATTTGACGGCCTG
TTGATGTATACAATTGAAGGCCGCAGGGATATTGCCGGGGGTCGTCTCATGACTGACAGA
AGATCTGCTGCTAATACAAGTATAGGAAAGTACTTCACAACGTTGTGCTATTCTGCTGAC
GGGACTTATATTTTAGCTGGAGGAAACAGCAAATATATATGCATGTATGATGTTGGAGAA
CAGGTGCTCTTGCGTAGATTCCAGATCACCCGCAATCTCTCGTTGGACGGAGTACTTGAT
TTTCTGAACTCAAAGAAGATGACGGATGCTGGTGCACTAGATCTGATTGATGATGAGGAT
AGTGATGTTGAGGAGGGGATCGATCAACAAACAAGAGGCAACTTGGGGCTTGGTTTGCCT
GGTTCCATGGCAAATCGTGGAAGGCCCATAGCTCGGACAAAATGCGTGAAATTTGCTCCA
ACAGGAAGATCTTTCGCTGCAGCAACCACTGATGGTGTTCTATTGTACTCTGTTGATGAT
TCTTTTATTTTTGATCCAACAGATCTTGACATTGATGTTACCCCTGAGAAAGTGGAAGAA
GCTCTTGAGGAAAACCAACAGCAAAGAGCCCTTCTACTCAGCCTCCGGTTAAATGAAGAC
TCCTTGATCAAGAAGTGCATTTTTTCAGTGGATCCATCCAATGTACGAGCAATTTGTTCA
TCAACACCCTTGAAGTATCTTCAGAGATTAATCGAAGCATTTTCTGACCTTTTGGAAAGT
TGTCCCCATCTTGAATTTATTCTCCTCTGGTCTCAGGAGCTATGCAAGATTCACGGAAAC
TATATTCAACAAAACTCCAGAGCCTTGCTTCCTGCTCTGAAGTCGTTTCAGAAGTCTATA
ACAAGAATTCATCAGGATTTGGCCGACACTTGTTCTTCTAATGAGTACATGTTGAAGTAT
CTGTGCTCTTCTGGGACGAGGAATTAGGTTATGGTTGAGAAATGCTGACAATTCAATACT
ATTGCAGGAAAGTGTTAACTGAGCAGCAGCACATCATCAGGCACCAGCTGAGTACTGGCC
ATCTGTACTGGACGCGATTCTCCGCGCTGCAGTCCTCGCCACAACTCGTCGGCCGAAGAG
CGAGTCGACCTGAGGCTTCGTCAGGCAGTGTGTTGCTTTTTTTGCCCAAAAGATGGACCC
TCTCGTCGACCATGAAAATTTTCCTTGTTGCCTGGTGTACTTTTCCTTGTTGGATCTTGG
ATGATGTGTGTACACACCTTACTGAAATTTTGTCACCCAGTTTTGTTGAAACGATCCAGA
AAGAATATATCATGCATCACAAGTATGGAGTACTTGTGGGTTTCCT

CDS

2667 bp

>Os05t0519500-02 WD40/YVTN repeat-like domain containing protein.
ATGAACTACCGCTTCCACAACCTCCTGGGCGCGCCGTACCGCGGCGGCGACGCCGTCTTC
GCCGGTGACTCCTCCGTCCTCCTCTCCGCCGTCGGCAACCGCGTCGCGTCCACCGACCTC
TCCGCCTCCTCCTCCCTCACGCTCCCCTTCGAGTCCTCCTCCAACGTCACCCGCCTCGCC
GTCTCCCCCTCGGGCGACTTCCTCCTCTCCGTCGACGACGCCGGCCGCGCGCTCTACGCC
AACCTCGGCCGCCGCGCCGTCCTCCACCGGATCGCCTTCAAGTCCGCCCCCTCCGCCGTC
CGCTTCAGCCCCGACGGCAACCTCATCGCCGTCGCCGTCGGTAAGCTCGTCCAGATCTGG
CGCTCGCCCGCGTTCCGCAAGGAGTTCTTCCCTTTCCACCTGCTCCGCACCATCCCTGGC
TTCGCCGCCGGTGTCACCGCCTTCGACTGGTCTCCCGACTCCTCGTTCCTCCTCGCCTCC
TGCAAGGACCTCACCGCCCGCCTCTTGCCTGTCAAGAAAGGCCTTGGAGGCAAACCATTC
CTCTTCGTTGGCCACCGCGCCGCCGTGGTTGGCGCCTTCTTCGCCACAGATAAGAAGACA
GGGAGAGTCACTGGGGCTTACACAATTACCAAGGACGGAGCTATCTTTACATGGAATTTG
GTGGAAGGAAGTGATGATTCGCCTCCACCTTCACCAGGGACGCCAGAGCAGGAGGCGGTA
CAGGATGGTGAGGCTGAATTGGACGGTGACGAGCCCGAATTGGATGGCGGGAGCAGGAAA
AGGAAGAGTTTCGGAGAATCGGAAGAACCAGACACTACCCCGCTGCATTTCACAAGGTGG
GAGCTGCAGAAAAAGGACTTCTTCATGCAGTCACCGGCTAAGTTAACAGCCTGTGATTAC
CATAGGGAGCTTGACATGGTGGTGGTTGGTTTCTCTAATGGTGTATTTGGGCTGTACCAG
ATGCCAGACTTTGTGTGCCTCCACTTACTGTCAATATCAAGGGAGAAGATCACTACTGCT
ATTTTCAACAGTTTGGGGAATTGGTTAGTTTTTGGATGTGCCAAACTTGGGCAATTACTG
GTGTGGGAGTGGCGATCAGAGAGCTACATTTTGAAGCAGCAGGGGCACTACTTTGATGTG
AACTGCATTGCATACTCACCAGACTCCCAATTACTGGCCACTGGAGCTGATGATAACAAA
GTCAAGGTCTGGACAGTCTCCTCTGGGTTCTGTTTCATAACATTTTCGGAGCATACAAAC
GCTGTTACTGCAGTTCATTTTATGGCCAATAATCATTCTCTTCTCAGTGCCTCCCTTGAT
GGGACTATTCGAGCATGGGATCTGTTCCGCTATCGAAATTTCAAGACATTTACTACTGCA
TTGCCCAGACAATTTGTTTCTTTAACGGCAGATCAGAGTGGAGAAGTAATATGTGCTGGA
ACACTTGATTCATTTGAGATATTTGTTTGGTCAATGAAGACTGGTCGTTTGTTGGATATA
CTCAGTGGTCACCAAGGACCAGTTCATGGCCTAATGTTTTCGCCAATCAATGCTATTTTG
GCTTCATCATCATGGGACAAAACAGTTCGCCTTTGGGACGTATTTGAGAGCAAGGGTGCA
GTGGAAACTTTTCAACATTCACATGATGTTCTTACTTTGGCTTATCGCCCTGATGGAAGA
CAGATAGCATGCAGCACACTAGATGGCTTAATCCATTTCTGGGATCCATTTGACGGCCTG
TTGATGTATACAATTGAAGGCCGCAGGGATATTGCCGGGGGTCGTCTCATGACTGACAGA
AGATCTGCTGCTAATACAAGTATAGGAAAGTACTTCACAACGTTGTGCTATTCTGCTGAC
GGGACTTATATTTTAGCTGGAGGAAACAGCAAATATATATGCATGTATGATGTTGGAGAA
CAGGTGCTCTTGCGTAGATTCCAGATCACCCGCAATCTCTCGTTGGACGGAGTACTTGAT
TTTCTGAACTCAAAGAAGATGACGGATGCTGGTGCACTAGATCTGATTGATGATGAGGAT
AGTGATGTTGAGGAGGGGATCGATCAACAAACAAGAGGCAACTTGGGGCTTGGTTTGCCT
GGTTCCATGGCAAATCGTGGAAGGCCCATAGCTCGGACAAAATGCGTGAAATTTGCTCCA
ACAGGAAGATCTTTCGCTGCAGCAACCACTGATGGTGTTCTATTGTACTCTGTTGATGAT
TCTTTTATTTTTGATCCAACAGATCTTGACATTGATGTTACCCCTGAGAAAGTGGAAGAA
GCTCTTGAGGAAAACCAACAGCAAAGAGCCCTTCTACTCAGCCTCCGGTTAAATGAAGAC
TCCTTGATCAAGAAGTGCATTTTTTCAGTGGATCCATCCAATGTACGAGCAATTTGTTCA
TCAACACCCTTGAAGTATCTTCAGAGATTAATCGAAGCATTTTCTGACCTTTTGGAAAGT
TGTCCCCATCTTGAATTTATTCTCCTCTGGTCTCAGGAGCTATGCAAGATTCACGGAAAC
TATATTCAACAAAACTCCAGAGCCTTGCTTCCTGCTCTGAAGTCGTTTCAGAAGTCTATA
ACAAGAATTCATCAGGATTTGGCCGACACTTGTTCTTCTAATGAGTACATGTTGAAGTAT
CTGTGCTCTTCTGGGACGAGGAATTAG

Protein

889 aa

>Os05t0519500-02 WD40/YVTN repeat-like domain containing protein.
MNYRFHNLLGAPYRGGDAVFAGDSSVLLSAVGNRVASTDLSASSSLTLPFESSSNVTRLA
VSPSGDFLLSVDDAGRALYANLGRRAVLHRIAFKSAPSAVRFSPDGNLIAVAVGKLVQIW
RSPAFRKEFFPFHLLRTIPGFAAGVTAFDWSPDSSFLLASCKDLTARLLPVKKGLGGKPF
LFVGHRAAVVGAFFATDKKTGRVTGAYTITKDGAIFTWNLVEGSDDSPPPSPGTPEQEAV
QDGEAELDGDEPELDGGSRKRKSFGESEEPDTTPLHFTRWELQKKDFFMQSPAKLTACDY
HRELDMVVVGFSNGVFGLYQMPDFVCLHLLSISREKITTAIFNSLGNWLVFGCAKLGQLL
VWEWRSESYILKQQGHYFDVNCIAYSPDSQLLATGADDNKVKVWTVSSGFCFITFSEHTN
AVTAVHFMANNHSLLSASLDGTIRAWDLFRYRNFKTFTTALPRQFVSLTADQSGEVICAG
TLDSFEIFVWSMKTGRLLDILSGHQGPVHGLMFSPINAILASSSWDKTVRLWDVFESKGA
VETFQHSHDVLTLAYRPDGRQIACSTLDGLIHFWDPFDGLLMYTIEGRRDIAGGRLMTDR
RSAANTSIGKYFTTLCYSADGTYILAGGNSKYICMYDVGEQVLLRRFQITRNLSLDGVLD
FLNSKKMTDAGALDLIDDEDSDVEEGIDQQTRGNLGLGLPGSMANRGRPIARTKCVKFAP
TGRSFAAATTDGVLLYSVDDSFIFDPTDLDIDVTPEKVEEALEENQQQRALLLSLRLNED
SLIKKCIFSVDPSNVRAICSSTPLKYLQRLIEAFSDLLESCPHLEFILLWSQELCKIHGN
YIQQNSRALLPALKSFQKSITRIHQDLADTCSSNEYMLKYLCSSGTRN*

CDS

chr05:25792317..25793522 (- strand) : 1206 bp

chr05:25791448..25791699 (- strand) : 252 bp

chr05:25791255..25791347 (- strand) : 93 bp

chr05:25790704..25791075 (- strand) : 372 bp

chr05:25789887..25790231 (- strand) : 345 bp

chr05:25789567..25789794 (- strand) : 228 bp

chr05:25789309..25789479 (- strand) : 171 bp

3'UTR

chr05:25789284..25789308 (- strand) : 25 bp

chr05:25788811..25789164 (- strand) : 354 bp

FASTA

>Os05t0519500-02 class=Sequence position=chr05:25788811..25793522 (- strand)
ATGAACTACC GCTTCCACAA CCTCCTGGGC GCGCCGTACC GCGGCGGCGA CGCCGTCTTC GCCGGTGACT CCTCCGTCCT
CCTCTCCGCC GTCGGCAACC GCGTCGCGTC CACCGACCTC TCCGCCTCCT CCTCCCTCAC GCTCCCCTTC GAGTCCTCCT
CCAACGTCAC CCGCCTCGCC GTCTCCCCCT CGGGCGACTT CCTCCTCTCC GTCGACGACG CCGGCCGCGC GCTCTACGCC
AACCTCGGCC GCCGCGCCGT CCTCCACCGG ATCGCCTTCA AGTCCGCCCC CTCCGCCGTC CGCTTCAGCC CCGACGGCAA
CCTCATCGCC GTCGCCGTCG GTAAGCTCGT CCAGATCTGG CGCTCGCCCG CGTTCCGCAA GGAGTTCTTC CCTTTCCACC
TGCTCCGCAC CATCCCTGGC TTCGCCGCCG GTGTCACCGC CTTCGACTGG TCTCCCGACT CCTCGTTCCT CCTCGCCTCC
TGCAAGGACC TCACCGCCCG CCTCTTGCCT GTCAAGAAAG GCCTTGGAGG CAAACCATTC CTCTTCGTTG GCCACCGCGC
CGCCGTGGTT GGCGCCTTCT TCGCCACAGA TAAGAAGACA GGGAGAGTCA CTGGGGCTTA CACAATTACC AAGGACGGAG
CTATCTTTAC ATGGAATTTG GTGGAAGGAA GTGATGATTC GCCTCCACCT TCACCAGGGA CGCCAGAGCA GGAGGCGGTA
CAGGATGGTG AGGCTGAATT GGACGGTGAC GAGCCCGAAT TGGATGGCGG GAGCAGGAAA AGGAAGAGTT TCGGAGAATC
GGAAGAACCA GACACTACCC CGCTGCATTT CACAAGGTGG GAGCTGCAGA AAAAGGACTT CTTCATGCAG TCACCGGCTA
AGTTAACAGC CTGTGATTAC CATAGGGAGC TTGACATGGT GGTGGTTGGT TTCTCTAATG GTGTATTTGG GCTGTACCAG
ATGCCAGACT TTGTGTGCCT CCACTTACTG TCAATATCAA GGGAGAAGAT CACTACTGCT ATTTTCAACA GTTTGGGGAA
TTGGTTAGTT TTTGGATGTG CCAAACTTGG GCAATTACTG GTGTGGGAGT GGCGATCAGA GAGCTACATT TTGAAGCAGC
AGGGGCACTA CTTTGATGTG AACTGCATTG CATACTCACC AGACTCCCAA TTACTGGCCA CTGGAGCTGA TGATAACAAA
GTCAAGGTGT GTGTTACAAG CAGTGACATT TGCACTCACT ATTATACGCT CATTCTAGTT GGCGATGGAG GAAATTTATT
GTTTTATGTC ATTCAAAAAA TGAAAACATC TTTTACGGTA GTACTAGATA GTGTTTTTAG TTTTGATGAA GAGATATTTC
AAGTAAAGAA ATCAATTCAT GAATGTTATG TGGGTAGTAG AAAGCAGTCG CTCTGCCTCT GAGCTAATAC TTATGTGAAG
CATATTAATG TCAACTGAAG ATTATAGTTG TCTATCTATA GAATTAGATG ATAATAAAAA TGATATAGTT ATATATTATG
ACCTTCTATG TTAGtactac ctccgttttt taatagatga cgccgctgac tttttctcac atgtttgacc attcgtctta
ttcaaaaaat ttacgtaatt ataatttatt ttgttatgag ttgttttatc actcatagta ctttaagtgt gatttatatc
ttatacattt gcataaaatt tttgaataag acaaatggtc aaacatgtga gaaaaaatca acagcgtcat ctattaaaaa
acggagggag taTTAGTATA CTGCACCCTG AGTTTGACAC ATACCACTTA TGATGTATTG CAGGTCTGGA CAGTCTCCTC
TGGGTTCTGT TTCATAACAT TTTCGGAGCA TACAAACGCT GTTACTGCAG TTCATTTTAT GGCCAATAAT CATTCTCTTC
TCAGTGCCTC CCTTGATGGG ACTATTCGAG CATGGGATCT GTTCCGCTAT CGAAATTTCA AGACATTTAC TACTGCATTG
CCCAGACAAT TTGTTTCTTT AACGGCAGAT CAGAGTGGAG AAGTAATATG TGCTGGAACA CTTGATTCAT TTGAGGTGTG
TGTGTGAAGT CAACCTTTTT GCTGCAGTTT TTTTCCCCGT GCATATGCTT CTCTTTTTCT CTCATTTTTT TGACTGTCAA
AACATCTTCA TGCAGATATT TGTTTGGTCA ATGAAGACTG GTCGTTTGTT GGATATACTC AGTGGTCACC AAGGACCAGT
TCATGGCCTA ATGTTTTCGC CAATCAATGT AAGAGCGCAT GTTTTATTCT ACCCCTGTTT TATTTCCTGC CTGTCAAACA
TTACTAAATA TAAACTACTT TAGTACAAAC ACTGGTACAC AATCTCTTTT TGCTCAATCT GCTGCGTTGT CTACTCTATA
TGTTGTGTAA ATCCACAGAA AGAGTTAAAC TGAATTCTGT CTGGTAGGCT ATTTTGGCTT CATCATCATG GGACAAAACA
GTTCGCCTTT GGGACGTATT TGAGAGCAAG GGTGCAGTGG AAACTTTTCA ACATTCACAT GATGTTCTTA CTTTGGCTTA
TCGCCCTGAT GGAAGACAGA TAGCATGCAG CACACTAGAT GGCTTAATCC ATTTCTGGGA TCCATTTGAC GGCCTGTTGA
TGTATACAAT TGAAGGCCGC AGGGATATTG CCGGGGGTCG TCTCATGACT GACAGAAGAT CTGCTGCTAA TACAAGTATA
GGAAAGTACT TCACAACGTT GTGCTATTCT GCTGACGGGA CTTATATTTT AGCTGGAGGA AACAGCAAAT ATATATGCAT
GTATGATGTT GGAGAACAGG TCAGGAAAGT TTTCTTATGA TGATAATGGC TTTTTAGTAT ATACACACAT CATCCATTTT
AAAACTTAAT TTTAGAGCTG CATCCATTTT TTTAATCGTG TGTACTCTCT ACAATTCCAT CATTGTCTGT AACTAATTTC
TATCTGGTGT TTGTATTTTG TTAATTGATC TGGAGAGCAC CCTCTATACT CTGATTTATT TTTGTGGATT TTAGTAGCTC
TCTGCCTTGG AACGATCTTC TTACAGTTTC TGCTCGTTCT GTTTTGTCAT TTGAATGTTG TTTTATAGAT GTCTAGCTCA
AACTTAGAAT GTCTTACCAC ATGTCCTTGT TGACATATAG TTAGTTTAGT TATTGGCACA TGTCCTTGTT GACATAGTTA
GTTTAGTTAT TGGTGTTATT TTGCACATGT TTTTCTTTTC TGTCCTAATT GTTGAAATAT CATTGTTTTT ATGTACCCAT
CACTTTTGTA GGTGCTCTTG CGTAGATTCC AGATCACCCG CAATCTCTCG TTGGACGGAG TACTTGATTT TCTGAACTCA
AAGAAGATGA CGGATGCTGG TGCACTAGAT CTGATTGATG ATGAGGATAG TGATGTTGAG GAGGGGATCG ATCAACAAAC
AAGAGGCAAC TTGGGGCTTG GTTTGCCTGG TTCCATGGCA AATCGTGGAA GGCCCATAGC TCGGACAAAA TGCGTGAAAT
TTGCTCCAAC AGGAAGATCT TTCGCTGCAG CAACCACTGA TGGTGTTCTA TTGTACTCTG TTGATGATTC TTTTATTTTT
GATCCAACAG ATCTTGACAT TGATGTTACC CCTGAGGTAT TTACCATATG TTCTTTCTTA TTAGTAGTTC TGTTCCAATT
ATACTAATCA ATTTGAAAAA TAAAATTTTG CACATGATGC TTCTGTAGAA AGTGGAAGAA GCTCTTGAGG AAAACCAACA
GCAAAGAGCC CTTCTACTCA GCCTCCGGTT AAATGAAGAC TCCTTGATCA AGAAGTGCAT TTTTTCAGTG GATCCATCCA
ATGTACGAGC AATTTGTTCA TCAACACCCT TGAAGTATCT TCAGAGATTA ATCGAAGCAT TTTCTGACCT TTTGGAAAGT
TGTCCCCATC TTGAATTTAT TCTCCTCTGG TCTCAGGTAC CATTATTGTT CTCTATATTG TTATTGAAGC TGATGATTTG
ATGGGAATAC CAGATTAATC TAATTCTAAT ATTTTTGTTA CAGGAGCTAT GCAAGATTCA CGGAAACTAT ATTCAACAAA
ACTCCAGAGC CTTGCTTCCT GCTCTGAAGT CGTTTCAGAA GTCTATAACA AGAATTCATC AGGATTTGGC CGACACTTGT
TCTTCTAATG AGTACATGTT GAAGTATCTG TGCTCTTCTG GGACGAGGAA TTAGGTTATG GTTGAGAAAT GCTGACAATG
TGAGTATTTC TTTTTTGCCG ATCATTACAT TTTGAATGTC ACAAAAAATA TAGTATAAAT GATTATCAAG TTTGTCAAAA
CAAAGATATC TGCAAGAGAT GTTTTAACGT TATTGCAGTC AATACTATTG CAGGAAAGTG TTAACTGAGC AGCAGCACAT
CATCAGGCAC CAGCTGAGTA CTGGCCATCT GTACTGGACG CGATTCTCCG CGCTGCAGTC CTCGCCACAA CTCGTCGGCC
GAAGAGCGAG TCGACCTGAG GCTTCGTCAG GCAGTGTGTT GCTTTTTTTG CCCAAAAGAT GGACCCTCTC GTCGACCATG
AAAATTTTCC TTGTTGCCTG GTGTACTTTT CCTTGTTGGA TCTTGGATGA TGTGTGTACA CACCTTACTG AAATTTTGTC
ACCCAGTTTT GTTGAAACGA TCCAGAAAGA ATATATCATG CATCACAAGT ATGGAGTACT TGTGGGTTTC CT