Os05t0519600-01

Locus

Os05g0519600

Description

Similar to 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDJ-1D, DJ-1D, OsDJ-1D.1, OsDJ-1D.2, OsDJ-1D.3, OsDJ-1D.4, OsDJ-1D.5

Oryzabase Gene Name Synonym(s)

DJ-1/PfpI domain containing protein D, DJ-1 protein D

Transcript Evidence

AK071101 (DDBJ, Best hit)

Protein Evidence

F2EG99 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023077J08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0519600-01)

RiceXPro (AK071101)

Others

Oryzabase (20915)

KEGG (Os05t0519600-01)

Transcript

961 bp

>Os05t0519600-01 Similar to 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme.
TATCCATTTGTTCCAGGCTCGAGCACTCCGTTCTCCCGGGTCTCCGGTGCTGCTCCCGCC
GCAGCCGGACACCCGAACGCGAAGCTCCAACTCTCCAATGCTCCCCTCGTCTCGTTACCT
CCTCGCCCCGGCCCCACTTCCCGCCATGGTGGTACGGCCACCGCCGCCGCATCCACCGAG
CCGCGGAACTTCCCCTCTCGCTCGGCCACCATTGTGCCGCGCCATGGCGCGGGCCGCCCC
CTCGCTCTCTGCCGCGGCCTCGACGGCTGCCTCCTCCTCGACGACTCCTGCCAAGAAGAA
GGTTCTCTTGCCCATCGCCATGGGCACGGAGGAGATGGAGGCAGTCATCCTTGCCGGTGT
ACTCCGCCGAGCCGGCGCCGACGTGACGCTGGCATCCGTGGAGGACGGCCTCGAGGTGGA
GGCCTCGCGTGGCTCCCACATCGTTGCTGACAAGCGCATTGCCGCTTGTGCAGACCAGGT
GTTCGACCTCGTGGCTCTCCCGTTGACAAAGGTTGACGATAATCTTGAAAGAAGTATTGA
AGTCAACGAAATTGAGTGGTCTTCTGATCACAATCCTCATGTTCTCATTCCAATTGCAAA
TGGTTCAGAAGAGATGGAGATAATAATGTTGACGGATGTTTTACGGCGAGCAAATGTAAA
TGTGGTGTTGGCATCAGTTGAAAAATCAACAAGTATTGTCGGGTCCCAAAGGATGAGGAT
TGTTGCTGATAAATGCATTTCAGATGCTTCTGCCTTAGAATATGATCTAATTATCCTTCC
TGTGAGCTATTTCTCATTTCATATTTTCATTTAGATATCATAAATGCCGACATATAAGTT
CATTGTTGTTCCTACAAGATATTTTGCATATAGCTGGTTCATGGACTGGTACAAATCCCC
ATCTTATCATCATCATGATGCTTGCTTTTAACCTTATCTTGAATGTAGCTGCATATTACT
G

CDS

717 bp

>Os05t0519600-01 Similar to 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme.
ATGCTCCCCTCGTCTCGTTACCTCCTCGCCCCGGCCCCACTTCCCGCCATGGTGGTACGG
CCACCGCCGCCGCATCCACCGAGCCGCGGAACTTCCCCTCTCGCTCGGCCACCATTGTGC
CGCGCCATGGCGCGGGCCGCCCCCTCGCTCTCTGCCGCGGCCTCGACGGCTGCCTCCTCC
TCGACGACTCCTGCCAAGAAGAAGGTTCTCTTGCCCATCGCCATGGGCACGGAGGAGATG
GAGGCAGTCATCCTTGCCGGTGTACTCCGCCGAGCCGGCGCCGACGTGACGCTGGCATCC
GTGGAGGACGGCCTCGAGGTGGAGGCCTCGCGTGGCTCCCACATCGTTGCTGACAAGCGC
ATTGCCGCTTGTGCAGACCAGGTGTTCGACCTCGTGGCTCTCCCGTTGACAAAGGTTGAC
GATAATCTTGAAAGAAGTATTGAAGTCAACGAAATTGAGTGGTCTTCTGATCACAATCCT
CATGTTCTCATTCCAATTGCAAATGGTTCAGAAGAGATGGAGATAATAATGTTGACGGAT
GTTTTACGGCGAGCAAATGTAAATGTGGTGTTGGCATCAGTTGAAAAATCAACAAGTATT
GTCGGGTCCCAAAGGATGAGGATTGTTGCTGATAAATGCATTTCAGATGCTTCTGCCTTA
GAATATGATCTAATTATCCTTCCTGTGAGCTATTTCTCATTTCATATTTTCATTTAG

Protein

239 aa

>Os05t0519600-01 Similar to 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme.
MLPSSRYLLAPAPLPAMVVRPPPPHPPSRGTSPLARPPLCRAMARAAPSLSAAASTAASS
STTPAKKKVLLPIAMGTEEMEAVILAGVLRRAGADVTLASVEDGLEVEASRGSHIVADKR
IAACADQVFDLVALPLTKVDDNLERSIEVNEIEWSSDHNPHVLIPIANGSEEMEIIMLTD
VLRRANVNVVLASVEKSTSIVGSQRMRIVADKCISDASALEYDLIILPVSYFSFHIFI*

5'UTR

chr05:25797606..25797702 (+ strand) : 97 bp

CDS

chr05:25797703..25797906 (+ strand) : 204 bp

chr05:25797990..25798190 (+ strand) : 201 bp

chr05:25799997..25800074 (+ strand) : 78 bp

chr05:25800306..25800539 (+ strand) : 234 bp

3'UTR

chr05:25800540..25800686 (+ strand) : 147 bp

FASTA

>Os05t0519600-01 class=Sequence position=chr05:25797606..25800686 (+ strand)
TATCCATTTG TTCCAGGCTC GAGCACTCCG TTCTCCCGGG TCTCCGGTGC TGCTCCCGCC GCAGCCGGAC ACCCGAACGC
GAAGCTCCAA CTCTCCAATG CTCCCCTCGT CTCGTTACCT CCTCGCCCCG GCCCCACTTC CCGCCATGGT GGTACGGCCA
CCGCCGCCGC ATCCACCGAG CCGCGGAACT TCCCCTCTCG CTCGGCCACC ATTGTGCCGC GCCATGGCGC GGGCCGCCCC
CTCGCTCTCT GCCGCGGCCT CGACGGCTGC CTCCTCCTCG ACGACTCCTG CCAAGAAGAA GGTCCGGTTT CCTACTCCTG
ACGTCAGACT CCACTATTTA GCAGTTTCAA GATCTTGATT TTGTACAGTT TGTGCTGTAA AAAGGTTCTC TTGCCCATCG
CCATGGGCAC GGAGGAGATG GAGGCAGTCA TCCTTGCCGG TGTACTCCGC CGAGCCGGCG CCGACGTGAC GCTGGCATCC
GTGGAGGACG GCCTCGAGGT GGAGGCCTCG CGTGGCTCCC ACATCGTTGC TGACAAGCGC ATTGCCGCTT GTGCAGACCA
GGTGTTCGAC CTCGTGGCTC TCCCGGTAAC TATCCCTATT CTCGTGCTGA CCCATCTATT TGgggaaact attttaatcc
ctcgagggga tatcctctcg ttctttgcat gtcactcaaa tggttatgaa aaaattgaaa acaattgaga aggtgtatta
acatgtgata taacactcca cgaacatgca agttcaaatt caacttctac atctcgtaac gaaaaaaaca aattaaaccg
caactagtta acgtatattc agagtcaaat ttgttttttt gttgcaagat ttagaagttg aatttttact tgcatgtttg
tggagtaatg tatcacatgt taatacatct tctcaaattt tttaaatttt ttcataacaa tttgagtgac atgcaaacaa
cgatgggata tcccctcaag ggatcaaaat cctcttccCA TCTATTTGTG TGGTTAGTTG GTTACGGATG TTGACATTAG
CAGTAGGAAT CAATTTTCAA GATCATTTAA GTCTTTCTCT ACGAAACAGA ATTCAAGTAC ATCTAAGCAC TATCTTTAGC
ATTGCAAAAA GTGGTCTATC ACATTTTCTC AGTTTTCCGA CTGATAGTAG TATCTGACAA TTTCGTCGCT CTATTCCCTT
TCTTGGACCT GTGGTGTTAT ATGTTTGTCA TAATGTCACA TACTGCCAGT GCCCAAAATC TTATCTTGGG TTCATGGTGT
GACGTGTTCA GGGTGGAATG CCTGGTTCAG TGCGGTTGAG AGACAGTGTG ATCCTTCAGA GGATCACAGT TAGACAGGCT
GAGGAAAAAA GATTGTATGG TGCTATATGT GCTGCACCAG CTGTTGTTCT CATGCCGTGG GGCCTCCACA AGAGAAAAAA
GGTGGTCATT TTGTGATCAG ACTAAATTTA GTAAATCAAC ATTTGGCCTT CTTTAGCTGA TATATATATA TTTTTTCCTT
TTGCCGTGCA AGATCACTTG TCACCCATCC TTTATAGAAG ATCTCCCAAC ATTCCGAACT GTTGAATCAA ATGTTCAGGT
GTCTGGAGAG CTAACAACAA GCCGTGGACC AGGGACAGCA TTTCAGTTTG CTTTATCATT TGTAGAGCAG TTGTTTGGGC
CTTGTAAAGC TGAAGATATG GACAACACTT TGGTTCGTTA AAAGAAAACC TTCACGTACT TCACATCTTG TCCTTTTTAA
GTTAATATGA TGAATGCTCT TCAAAACTTA TACTCACAAG TGAAAAAAAA ATCTCTTCAA AACCACTTAG CTCTTTTCAT
attattcact ggattgttga aacggattat ttactccacg cttaaaagaa taagttttct caaaaacttt cttcataata
ttgcttagac cacctgtttt aggttatttg ttaagtatat ttatcaaaat atttaattca tccctatagt caagtagata
atccgcaata acaatctgct caataacctG TTTCAAACTG AGCCAGTTTT TTAAGAGTTG CTAAATGTTC TGCAATTTTA
TTTATTTTCA TAATGTTTCT TATATTTCAG TTGGCTATGC TGGAAAATCT CTACACTATG TTTTGTAGCT ATTGTGTTTT
ACATTATAAC ACTAATCCAT GCTGATCATT GTGCAATTAT TGTATAGTAA TCTCTAATAT TTCAAGGGAT AACCCCTTCT
TTCTACAATT TTTAGTGCAA TACTAGTACA TGATTATGAT TCTACGATTA TTATATAGTC AGCTAAAATT TTTAAGCAAC
AATTCTATTT ATTTGCATTG CAACACAAAT AGATGCTGAC TGCTGTTCAA TTATTGTGTA CTCTCTTACA GTTGACAAAG
GTTGACGATA ATCTTGAAAG AAGTATTGAA GTCAACGAAA TTGAGTGGTC TTCTGATCAC AATCCTCATG TAAGTACAGA
AAACAATCGT GTACCTTAGA TTTTTGTGCA AGAATGAATA TGGCATGATA CTAATACAAA TATGAAATAT AGTGAAGCAT
AGAAATGTTC TATTGAACTA TGGATAGGTT AAAATCTCAA AGATGCATGC TTGATGTAAT GGAGCTCCAT TTGGTTGCAT
ATGGCCTGCA GCACTAGTAT TTTGTGTAGT TGATAGAACG CCTTTTGACT TCTGGAACAG GTTCTCATTC CAATTGCAAA
TGGTTCAGAA GAGATGGAGA TAATAATGTT GACGGATGTT TTACGGCGAG CAAATGTAAA TGTGGTGTTG GCATCAGTTG
AAAAATCAAC AAGTATTGTC GGGTCCCAAA GGATGAGGAT TGTTGCTGAT AAATGCATTT CAGATGCTTC TGCCTTAGAA
TATGATCTAA TTATCCTTCC TGTGAGCTAT TTCTCATTTC ATATTTTCAT TTAGATATCA TAAATGCCGA CATATAAGTT
CATTGTTGTT CCTACAAGAT ATTTTGCATA TAGCTGGTTC ATGGACTGGT ACAAATCCCC ATCTTATCAT CATCATGATG
CTTGCTTTTA ACCTTATCTT GAATGTAGCT GCATATTACT G

Locus: Os05g0519600

Loading...

Locus: Os05g0519600

Loading...