Os05t0519600-02

Locus

Os05g0519600

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDJ-1D, DJ-1D, OsDJ-1D.1, OsDJ-1D.2, OsDJ-1D.3, OsDJ-1D.4, OsDJ-1D.5

Oryzabase Gene Name Synonym(s)

DJ-1/PfpI domain containing protein D, DJ-1 protein D

Transcript Evidence

AK102422 (DDBJ, Best hit)

Protein Evidence

Q6F2Y9 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

ThiJ/PfpI (IPR002818)

DJ-1 (IPR006287)

Full-length cDNA

J033093E03 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0519600-02)

RiceXPro (AK102422)

Others

Oryzabase (20915)

KEGG (Os05t0519600-02)

Transcript

2089 bp

>Os05t0519600-02 Hypothetical conserved gene.
GTTCCAGGCTCGAGCACTCCGTTCTCCCGGGTCTCCGGTGCTGCTCCCGCCGCAGCCGGA
CACCCGAACGCGAAGCTCCAACTCTCCAATGCTCCCCTCGTCTCGTTACCTCCTCGCCCC
GGCCCCACTTCCCGCCATGGTGGTACGGCCACCGCCGCCGCATCCACCGAGCCGCGGAAC
TTCCCCTCTCGCTCGGCCACCATTGTGCCGCGCCATGGCGCGGGCCGCCCCCTCGCTCTC
TGCCGCGGCCTCGACGGCTGCCTCCTCCTCGACGACTCCTGCCAAGAAGAAGGTTCTCTT
GCCCATCGCCATGGGCACGGAGGAGATGGAGGCAGTCATCCTTGCCGGTGTACTCCGCCG
AGCCGGCGCCGACGTGACGCTGGCATCCGTGGAGGACGGCCTCGAGGTGGAGGCCTCGCG
TGGCTCCCACATCGTTGCTGACAAGCGCATTGCCGCTTGTGCAGACCAGGTGTTCGACCT
CGTGGCTCTCCCGGGTGGAATGCCTGGTTCAGTGCGGTTGAGAGACAGTGTGATCCTTCA
GAGGATCACAGTTAGACAGGCTGAGGAAAAAAGATTGTATGGTGCTATATGTGCTGCACC
AGCTGTTGTTCTCATGCCGTGGGGCCTCCACAAGAGAAAAAAGATCACTTGTCACCCATC
CTTTATAGAAGATCTCCCAACATTCCGAACTGTTGAATCAAATGTTCAGGTGTCTGGAGA
GCTAACAACAAGCCGTGGACCAGGGACAGCATTTCAGTTTGCTTTATCATTTGTAGAGCA
GTTGTTTGGGCCTTGTAAAGCTGAAGATATGGACAACACTTTGTTGACAAAGGTTGACGA
TAATCTTGAAAGAAGTATTGAAGTCAACGAAATTGAGTGGTCTTCTGATCACAATCCTCA
TGTTCTCATTCCAATTGCAAATGGTTCAGAAGAGATGGAGATAATAATGTTGACGGATGT
TTTACGGCGAGCAAATGTAAATGTGGTGTTGGCATCAGTTGAAAAATCAACAAGTATTGT
CGGGTCCCAAAGGATGAGGATTGTTGCTGATAAATGCATTTCAGATGCTTCTGCCTTAGA
ATATGATCTAATTATCCTTCCTGGAGGACCTGCCGGAGCTGAGAGACTGCACAAGTCCAG
TGTTCTTAAGAAATTACTCAAGGAACAAAAGCAAACAGGCAGGATGTATGGTGGGATCTG
TTCTTCTCCTGTGATCTTGCAGAAGCAGGGTTTACTCCAGGATAAAACAGTGACAGCTCA
TCCTTCCATAGTCAATCAGCTCACGTGTGAAGTTATTGATCGATCAAAGGTTGTGATTGA
TGGAAATTTGATTACCGGGATGGGGCTTGGGACGGTCATTGATTTTTCGCTGGCTATTAT
TAAAAAATTCTTTGGCCATGGACGAGCCAAAGGCGTGGCAAATGGCATGGTTTTTGAGTA
TCCCAAGAGCTGAAACACCTAAAATATATCTGGCACTCTGTAATACGCAGACGTGAGACA
TTTAGTTGTGCTACAAGTATATTGCAGTAGCTACGCTTGAGACAAAGGTCACCGGTGCTC
TTCGTCTTGCTGTTTTATGGGCCTTCAACTCTTCTTGAGACAACAACATATTCCTCTGTT
GCGTCATTGGACATCTGGACGGAAATCATTCCACTATATTTGTTGGGATGGACCATTTAC
ATTGAGAAGATTCGGTGGAGGTCAATTCATCTCGATATGATCTGTTGGCACATTACGACA
CAGGTTGATTACTAACTGGATCTAAATATTGCAACTGATCAAGTGATGATAACCTTCTGC
TTGACGGATGCGCTTTTAGAAGAAACCCATCATGTTCAGTGGGGCTTCCAAGGACCTGAA
GCCCTTTTGATGTTGCTCTTATGCCCAGCTATCCAATCTGATAGTAGAGACTTCCAGCCT
GCGACAAACCAATTTAGCTTCAAAATTCAGATCTTTTTTCAGCAATTTTGTTGCCTGAAT
TCTGAAGTTAACTGGCAATGTAGTACAATGGATTCCCTCAATTTGCTCGATAGTTGATCA
GATAATTTGCTCGATAGTTGATCAAATATTTGTTGCAACAAACATGCTC

CDS

1365 bp

>Os05t0519600-02 Hypothetical conserved gene.
ATGCTCCCCTCGTCTCGTTACCTCCTCGCCCCGGCCCCACTTCCCGCCATGGTGGTACGG
CCACCGCCGCCGCATCCACCGAGCCGCGGAACTTCCCCTCTCGCTCGGCCACCATTGTGC
CGCGCCATGGCGCGGGCCGCCCCCTCGCTCTCTGCCGCGGCCTCGACGGCTGCCTCCTCC
TCGACGACTCCTGCCAAGAAGAAGGTTCTCTTGCCCATCGCCATGGGCACGGAGGAGATG
GAGGCAGTCATCCTTGCCGGTGTACTCCGCCGAGCCGGCGCCGACGTGACGCTGGCATCC
GTGGAGGACGGCCTCGAGGTGGAGGCCTCGCGTGGCTCCCACATCGTTGCTGACAAGCGC
ATTGCCGCTTGTGCAGACCAGGTGTTCGACCTCGTGGCTCTCCCGGGTGGAATGCCTGGT
TCAGTGCGGTTGAGAGACAGTGTGATCCTTCAGAGGATCACAGTTAGACAGGCTGAGGAA
AAAAGATTGTATGGTGCTATATGTGCTGCACCAGCTGTTGTTCTCATGCCGTGGGGCCTC
CACAAGAGAAAAAAGATCACTTGTCACCCATCCTTTATAGAAGATCTCCCAACATTCCGA
ACTGTTGAATCAAATGTTCAGGTGTCTGGAGAGCTAACAACAAGCCGTGGACCAGGGACA
GCATTTCAGTTTGCTTTATCATTTGTAGAGCAGTTGTTTGGGCCTTGTAAAGCTGAAGAT
ATGGACAACACTTTGTTGACAAAGGTTGACGATAATCTTGAAAGAAGTATTGAAGTCAAC
GAAATTGAGTGGTCTTCTGATCACAATCCTCATGTTCTCATTCCAATTGCAAATGGTTCA
GAAGAGATGGAGATAATAATGTTGACGGATGTTTTACGGCGAGCAAATGTAAATGTGGTG
TTGGCATCAGTTGAAAAATCAACAAGTATTGTCGGGTCCCAAAGGATGAGGATTGTTGCT
GATAAATGCATTTCAGATGCTTCTGCCTTAGAATATGATCTAATTATCCTTCCTGGAGGA
CCTGCCGGAGCTGAGAGACTGCACAAGTCCAGTGTTCTTAAGAAATTACTCAAGGAACAA
AAGCAAACAGGCAGGATGTATGGTGGGATCTGTTCTTCTCCTGTGATCTTGCAGAAGCAG
GGTTTACTCCAGGATAAAACAGTGACAGCTCATCCTTCCATAGTCAATCAGCTCACGTGT
GAAGTTATTGATCGATCAAAGGTTGTGATTGATGGAAATTTGATTACCGGGATGGGGCTT
GGGACGGTCATTGATTTTTCGCTGGCTATTATTAAAAAATTCTTTGGCCATGGACGAGCC
AAAGGCGTGGCAAATGGCATGGTTTTTGAGTATCCCAAGAGCTGA

Protein

455 aa

>Os05t0519600-02 Hypothetical conserved gene.
MLPSSRYLLAPAPLPAMVVRPPPPHPPSRGTSPLARPPLCRAMARAAPSLSAAASTAASS
STTPAKKKVLLPIAMGTEEMEAVILAGVLRRAGADVTLASVEDGLEVEASRGSHIVADKR
IAACADQVFDLVALPGGMPGSVRLRDSVILQRITVRQAEEKRLYGAICAAPAVVLMPWGL
HKRKKITCHPSFIEDLPTFRTVESNVQVSGELTTSRGPGTAFQFALSFVEQLFGPCKAED
MDNTLLTKVDDNLERSIEVNEIEWSSDHNPHVLIPIANGSEEMEIIMLTDVLRRANVNVV
LASVEKSTSIVGSQRMRIVADKCISDASALEYDLIILPGGPAGAERLHKSSVLKKLLKEQ
KQTGRMYGGICSSPVILQKQGLLQDKTVTAHPSIVNQLTCEVIDRSKVVIDGNLITGMGL
GTVIDFSLAIIKKFFGHGRAKGVANGMVFEYPKS*

5'UTR

chr05:25797615..25797702 (+ strand) : 88 bp

CDS

chr05:25797703..25797906 (+ strand) : 204 bp

chr05:25797990..25798190 (+ strand) : 201 bp

chr05:25798897..25799046 (+ strand) : 150 bp

chr05:25799138..25799317 (+ strand) : 180 bp

chr05:25799997..25800074 (+ strand) : 78 bp

chr05:25800306..25800506 (+ strand) : 201 bp

chr05:25801610..25801747 (+ strand) : 138 bp

chr05:25801828..25802040 (+ strand) : 213 bp

3'UTR

chr05:25802041..25802345 (+ strand) : 305 bp

chr05:25802852..25803182 (+ strand) : 331 bp

FASTA

>Os05t0519600-02 class=Sequence position=chr05:25797615..25803182 (+ strand)
GTTCCAGGCT CGAGCACTCC GTTCTCCCGG GTCTCCGGTG CTGCTCCCGC CGCAGCCGGA CACCCGAACG CGAAGCTCCA
ACTCTCCAAT GCTCCCCTCG TCTCGTTACC TCCTCGCCCC GGCCCCACTT CCCGCCATGG TGGTACGGCC ACCGCCGCCG
CATCCACCGA GCCGCGGAAC TTCCCCTCTC GCTCGGCCAC CATTGTGCCG CGCCATGGCG CGGGCCGCCC CCTCGCTCTC
TGCCGCGGCC TCGACGGCTG CCTCCTCCTC GACGACTCCT GCCAAGAAGA AGGTCCGGTT TCCTACTCCT GACGTCAGAC
TCCACTATTT AGCAGTTTCA AGATCTTGAT TTTGTACAGT TTGTGCTGTA AAAAGGTTCT CTTGCCCATC GCCATGGGCA
CGGAGGAGAT GGAGGCAGTC ATCCTTGCCG GTGTACTCCG CCGAGCCGGC GCCGACGTGA CGCTGGCATC CGTGGAGGAC
GGCCTCGAGG TGGAGGCCTC GCGTGGCTCC CACATCGTTG CTGACAAGCG CATTGCCGCT TGTGCAGACC AGGTGTTCGA
CCTCGTGGCT CTCCCGGTAA CTATCCCTAT TCTCGTGCTG ACCCATCTAT TTGgggaaac tattttaatc cctcgagggg
atatcctctc gttctttgca tgtcactcaa atggttatga aaaaattgaa aacaattgag aaggtgtatt aacatgtgat
ataacactcc acgaacatgc aagttcaaat tcaacttcta catctcgtaa cgaaaaaaac aaattaaacc gcaactagtt
aacgtatatt cagagtcaaa tttgtttttt tgttgcaaga tttagaagtt gaatttttac ttgcatgttt gtggagtaat
gtatcacatg ttaatacatc ttctcaaatt ttttaaattt tttcataaca atttgagtga catgcaaaca acgatgggat
atcccctcaa gggatcaaaa tcctcttccC ATCTATTTGT GTGGTTAGTT GGTTACGGAT GTTGACATTA GCAGTAGGAA
TCAATTTTCA AGATCATTTA AGTCTTTCTC TACGAAACAG AATTCAAGTA CATCTAAGCA CTATCTTTAG CATTGCAAAA
AGTGGTCTAT CACATTTTCT CAGTTTTCCG ACTGATAGTA GTATCTGACA ATTTCGTCGC TCTATTCCCT TTCTTGGACC
TGTGGTGTTA TATGTTTGTC ATAATGTCAC ATACTGCCAG TGCCCAAAAT CTTATCTTGG GTTCATGGTG TGACGTGTTC
AGGGTGGAAT GCCTGGTTCA GTGCGGTTGA GAGACAGTGT GATCCTTCAG AGGATCACAG TTAGACAGGC TGAGGAAAAA
AGATTGTATG GTGCTATATG TGCTGCACCA GCTGTTGTTC TCATGCCGTG GGGCCTCCAC AAGAGAAAAA AGGTGGTCAT
TTTGTGATCA GACTAAATTT AGTAAATCAA CATTTGGCCT TCTTTAGCTG ATATATATAT ATTTTTTCCT TTTGCCGTGC
AAGATCACTT GTCACCCATC CTTTATAGAA GATCTCCCAA CATTCCGAAC TGTTGAATCA AATGTTCAGG TGTCTGGAGA
GCTAACAACA AGCCGTGGAC CAGGGACAGC ATTTCAGTTT GCTTTATCAT TTGTAGAGCA GTTGTTTGGG CCTTGTAAAG
CTGAAGATAT GGACAACACT TTGGTTCGTT AAAAGAAAAC CTTCACGTAC TTCACATCTT GTCCTTTTTA AGTTAATATG
ATGAATGCTC TTCAAAACTT ATACTCACAA GTGAAAAAAA AATCTCTTCA AAACCACTTA GCTCTTTTCA Tattattcac
tggattgttg aaacggatta tttactccac gcttaaaaga ataagttttc tcaaaaactt tcttcataat attgcttaga
ccacctgttt taggttattt gttaagtata tttatcaaaa tatttaattc atccctatag tcaagtagat aatccgcaat
aacaatctgc tcaataacct GTTTCAAACT GAGCCAGTTT TTTAAGAGTT GCTAAATGTT CTGCAATTTT ATTTATTTTC
ATAATGTTTC TTATATTTCA GTTGGCTATG CTGGAAAATC TCTACACTAT GTTTTGTAGC TATTGTGTTT TACATTATAA
CACTAATCCA TGCTGATCAT TGTGCAATTA TTGTATAGTA ATCTCTAATA TTTCAAGGGA TAACCCCTTC TTTCTACAAT
TTTTAGTGCA ATACTAGTAC ATGATTATGA TTCTACGATT ATTATATAGT CAGCTAAAAT TTTTAAGCAA CAATTCTATT
TATTTGCATT GCAACACAAA TAGATGCTGA CTGCTGTTCA ATTATTGTGT ACTCTCTTAC AGTTGACAAA GGTTGACGAT
AATCTTGAAA GAAGTATTGA AGTCAACGAA ATTGAGTGGT CTTCTGATCA CAATCCTCAT GTAAGTACAG AAAACAATCG
TGTACCTTAG ATTTTTGTGC AAGAATGAAT ATGGCATGAT ACTAATACAA ATATGAAATA TAGTGAAGCA TAGAAATGTT
CTATTGAACT ATGGATAGGT TAAAATCTCA AAGATGCATG CTTGATGTAA TGGAGCTCCA TTTGGTTGCA TATGGCCTGC
AGCACTAGTA TTTTGTGTAG TTGATAGAAC GCCTTTTGAC TTCTGGAACA GGTTCTCATT CCAATTGCAA ATGGTTCAGA
AGAGATGGAG ATAATAATGT TGACGGATGT TTTACGGCGA GCAAATGTAA ATGTGGTGTT GGCATCAGTT GAAAAATCAA
CAAGTATTGT CGGGTCCCAA AGGATGAGGA TTGTTGCTGA TAAATGCATT TCAGATGCTT CTGCCTTAGA ATATGATCTA
ATTATCCTTC CTGTGAGCTA TTTCTCATTT CATATTTTCA TTTAGATATC ATAAATGCCG ACATATAAGT TCATTGTTGT
TCCTACAAGA TATTTTGCAT ATAGCTGGTT CATGGACTGG TACAAATCCC CATCTTATCA TCATCATGAT GCTTGCTTTT
AACCTTATCT TGAATGTAGC TGCATATTAC TGATAAAAGT AAGTCCATTC TGAAATGCAT TCCTAACAAG CATGATCAAC
CATGGTGAGC TTTTGCTGTT CTATGCGTAG GACTTGACCT TCATACCGAA TTGTGTATCA GCTCGAGAAA AAAAAAAGAA
AGAACAAATA TACTTATCGC TATATCCTTA CATTTGGACC AGTTGTATGT GTCACTGACA GCCTTTAGGA CTTCAGGATA
TCGCTATCAC CTGTATTAGA ATACATGTTT CTTCTGTTTC CTTAGACATT TTCTTTTGTT TTAGTGAAGC AGAATTTTAT
AGAACCACTG TCTTGGACTC TTGATGCAAC TGTATTGAAG TATATTTGTA TCTTATCACG TGCATGGTTC ATAGCGACAT
CTGTACATTT CTCCGCTAAA ATATTGTGTG TTGGTTGTAC AAAGTGAAAT CTAGGTCCCA GGATTTCTTA CCATCAATGT
GGTCAAAAGA ATAATAAAAA AGCAGTTTCT TGGCGATTGT CAGAATTACA TGTTCTTTTC GGGAAATACT TTTTATGTAT
ATGAGATCTC TGGACTTCTT TACTTCTATA TCATGAAAAA GAAGATAATC CAAAGGAAAG GCGAGAGCAC CAAAAGAAAC
AGATGTTTTG ACTTTTGAGG AGGGATTGCT GGTTGTCTCA AATCTTAATC CTCTACTGGA CACAGAAAAA AAAAAGGGCG
CAATGTCAAT TCCTATCCTT GTATTTGTTT TGTCAATCAA ATCCTTGGTT GTAGCACTGG GGACATTAGC CTTTCAAAAA
ACTATCGGAG ACTTTGCTAG CAACCTATCT AAAATTTCAG CCCTCCAAGT GTGTGTATTT GTGCTCTCTA TTTCACTTTT
TTTGTGCTTT TTCAGCTAAT ATATTCACTT ATTTTGGTTC TAATTTCATT GTGTGTATCT CTTGACATTT TCTAGGGAGG
ACCTGCCGGA GCTGAGAGAC TGCACAAGTC CAGTGTTCTT AAGAAATTAC TCAAGGAACA AAAGCAAACA GGCAGGATGT
ATGGTGGGAT CTGTTCTTCT CCTGTGATCT TGCAGAAGCA GGGTTTACTC CAGGTGACAT TCTAGGACTA AAAACTCTTG
GCATCTTATA TTCTCTGGCA TGGAAGATAA CTGCCATTGA AATTGTTGAT CAGGATAAAA CAGTGACAGC TCATCCTTCC
ATAGTCAATC AGCTCACGTG TGAAGTTATT GATCGATCAA AGGTTGTGAT TGATGGAAAT TTGATTACCG GGATGGGGCT
TGGGACGGTC ATTGATTTTT CGCTGGCTAT TATTAAAAAA TTCTTTGGCC ATGGACGAGC CAAAGGCGTG GCAAATGGCA
TGGTTTTTGA GTATCCCAAG AGCTGAAACA CCTAAAATAT ATCTGGCACT CTGTAATACG CAGACGTGAG ACATTTAGTT
GTGCTACAAG TATATTGCAG TAGCTACGCT TGAGACAAAG GTCACCGGTG CTCTTCGTCT TGCTGTTTTA TGGGCCTTCA
ACTCTTCTTG AGACAACAAC ATATTCCTCT GTTGCGTCAT TGGACATCTG GACGGAAATC ATTCCACTAT ATTTGTTGGG
ATGGACCATT TACATTGAGA AGATTCGGTG GAGGTCAATT CATCTCGATA TGATCTGTTG GCACATTACG ACACAGGTTG
ATTACTAACT GGTAAGTTAt actccctcca ttcaaaatat ttgacaccat tgacttttta tagtgcgtgt ttgaccattc
gtcttattca aaaaatttaa gtaattattt attattttca tatcatttga ttcattgtta aatatacttt catatacaca
tatagtttta catatttcac aatttttttt aataagatga acggtcaaac atgtactaaa aagtcaacgg tgtcaaacat
tttgaaacgg agggagtaTT TGATAGTGAT AGGCATAAAT GTTTGAGTTC TAACACAAAT GATCTTTTCT CCTATTCTTA
GGACTATGAA TACAATGTGC TGTGCACTGA AAAGATAAAC CTAACATTAT AGCTTATAAA CTGATAATTT GGTGGTACGG
TGTTGTTAAA ACATTCCTTT TGCTTTTCTC CCCAAGTACT TGTGTTGCAT AGATAAAGCC ATTTGTAGGA TATGAGCTGA
TATGCTGTAT AATATCTTCA TTCTCTTCAA TTGACAGGAT CTAAATATTG CAACTGATCA AGTGATGATA ACCTTCTGCT
TGACGGATGC GCTTTTAGAA GAAACCCATC ATGTTCAGTG GGGCTTCCAA GGACCTGAAG CCCTTTTGAT GTTGCTCTTA
TGCCCAGCTA TCCAATCTGA TAGTAGAGAC TTCCAGCCTG CGACAAACCA ATTTAGCTTC AAAATTCAGA TCTTTTTTCA
GCAATTTTGT TGCCTGAATT CTGAAGTTAA CTGGCAATGT AGTACAATGG ATTCCCTCAA TTTGCTCGAT AGTTGATCAG
ATAATTTGCT CGATAGTTGA TCAAATATTT GTTGCAACAA ACATGCTC

Locus: Os05g0519600

Loading...

Locus: Os05g0519600

Loading...