Os05t0523300-01

Locus

Os05g0523300

Description

Similar to IAA8 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA18

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA18

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 18

Transcript Evidence

AK071192 (DDBJ, Best hit)

Protein Evidence

Q5W670 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J023087E13 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0523300-01)

RiceXPro (AK071192)

Others

Oryzabase (10907)

KEGG (Os05t0523300-01)

Transcript

1396 bp

>Os05t0523300-01 Similar to IAA8 (Fragment).
ATCGTTTCCCAACTTCATATGTAGTATATCATTTATGGTAGAGTTTTTGAGTGTTGAAGC
CCTTAACATTGGCACTGTAGTCCTTCCTCAGCTCCACATACCACCATCTATTCATTTTAA
CACAAAGATTTTCCTCTTGTTCCTTTTTCTTAGAGAATTCATATTTCCTATAGCAGATCA
AGTCCTATGGAAGAAGAATTCAAGGACAAAGGCCTCCCTCCCACGCTGCTACACCTCATC
CCTGACGGGAGAGAATGGAAGGTGAAAGAAGCAGATGGAGAAGGATCAAGGAACACAAAC
TTAGATGCCGATGAGGATAAGGAGCTAGAGCTTAAGCTCGGCCTCCCTGGTGTCCAACAG
GAAGAGAGAGCAGCTGATTCAAGAGAGAAGATACAGCAGCAACAACGAGAGAGTTCCTCA
GAACCATCCATCGGTTGCTTCCCTACACATTCAAAGCCTACCACCAGCATCGGCACAACT
GGGGCAAAGAGAGGATTTTTTGCGATTGTTGGGGCCACACTAGAAGGTTATAATCAGAGC
CACCGGGACACAGAAGAATGTGGGAAGGAGCTAACGTTAGGAGATGAAAATATGGCAGGT
GAGAGGAAGAAAGGATGCTGTCCCTCACCACCATGCTCAGCTGCAGCGCACAGCAGCAAC
CCCCAGGGGAGAGGTGCTATTCCTCCAGTAGTCGGTTGGCCTCCAATCCGGTCCTTCAGG
AGAAACCTCACAAATGGCAGTTCATTTAAACAGTCCCCTGAACGACAAAATGACGAAGCT
GATGACAAGGCAAAGCCAATCTGCAAGAAGAGACCTCTTGTCAAAATCAACATGGATGGG
ATCCCCATTGGAAGGAAAGTAGACCTTCAAATATACGACAGCTACCAGAAGCTGTCATCT
GCTGTTGAAGAGTTGTTCCGTGGTTTTCTTGAAGCTCAAAAAGATCTATCTTGTGCTGAA
AGTGGAGAGCAAGGGGCAGAAGACAAAATATTTTCAGGGTTGTTGGATGGAACTGGTGTA
TACACTTTAGTATATGAAGACAATGATGGAGACAGAATGTTAGCTGGGGACATACCATGG
AAGGTATTTGTTTCGACTGTTAAGAGGTTGAGGGTTATGAGGAGGTCAGAACTTCCCCAT
GACATGATTGGAGCTGACCCTGTGAAGTAGCAAATCGTTGATATTAGGGTCCAGACATAT
CAATTGTGCAAACCATAGTCCATCACCTTTCTGGGGGATGACCTGTTTTTGGCTTGTACA
GATGATTATGATAATGGGAAAATAGCATCTTGCAGGTGCAGTGGACAAACTGCATATTTT
GTAAATGACCTACTCTTTTTCAGATATAACAGATTGGTGTAATTCTATAAGTTATAGATT
TCTTGACAAAGGTGCC

CDS

984 bp

>Os05t0523300-01 Similar to IAA8 (Fragment).
ATGGAAGAAGAATTCAAGGACAAAGGCCTCCCTCCCACGCTGCTACACCTCATCCCTGAC
GGGAGAGAATGGAAGGTGAAAGAAGCAGATGGAGAAGGATCAAGGAACACAAACTTAGAT
GCCGATGAGGATAAGGAGCTAGAGCTTAAGCTCGGCCTCCCTGGTGTCCAACAGGAAGAG
AGAGCAGCTGATTCAAGAGAGAAGATACAGCAGCAACAACGAGAGAGTTCCTCAGAACCA
TCCATCGGTTGCTTCCCTACACATTCAAAGCCTACCACCAGCATCGGCACAACTGGGGCA
AAGAGAGGATTTTTTGCGATTGTTGGGGCCACACTAGAAGGTTATAATCAGAGCCACCGG
GACACAGAAGAATGTGGGAAGGAGCTAACGTTAGGAGATGAAAATATGGCAGGTGAGAGG
AAGAAAGGATGCTGTCCCTCACCACCATGCTCAGCTGCAGCGCACAGCAGCAACCCCCAG
GGGAGAGGTGCTATTCCTCCAGTAGTCGGTTGGCCTCCAATCCGGTCCTTCAGGAGAAAC
CTCACAAATGGCAGTTCATTTAAACAGTCCCCTGAACGACAAAATGACGAAGCTGATGAC
AAGGCAAAGCCAATCTGCAAGAAGAGACCTCTTGTCAAAATCAACATGGATGGGATCCCC
ATTGGAAGGAAAGTAGACCTTCAAATATACGACAGCTACCAGAAGCTGTCATCTGCTGTT
GAAGAGTTGTTCCGTGGTTTTCTTGAAGCTCAAAAAGATCTATCTTGTGCTGAAAGTGGA
GAGCAAGGGGCAGAAGACAAAATATTTTCAGGGTTGTTGGATGGAACTGGTGTATACACT
TTAGTATATGAAGACAATGATGGAGACAGAATGTTAGCTGGGGACATACCATGGAAGGTA
TTTGTTTCGACTGTTAAGAGGTTGAGGGTTATGAGGAGGTCAGAACTTCCCCATGACATG
ATTGGAGCTGACCCTGTGAAGTAG

Protein

328 aa

>Os05t0523300-01 Similar to IAA8 (Fragment).
MEEEFKDKGLPPTLLHLIPDGREWKVKEADGEGSRNTNLDADEDKELELKLGLPGVQQEE
RAADSREKIQQQQRESSSEPSIGCFPTHSKPTTSIGTTGAKRGFFAIVGATLEGYNQSHR
DTEECGKELTLGDENMAGERKKGCCPSPPCSAAAHSSNPQGRGAIPPVVGWPPIRSFRRN
LTNGSSFKQSPERQNDEADDKAKPICKKRPLVKINMDGIPIGRKVDLQIYDSYQKLSSAV
EELFRGFLEAQKDLSCAESGEQGAEDKIFSGLLDGTGVYTLVYEDNDGDRMLAGDIPWKV
FVSTVKRLRVMRRSELPHDMIGADPVK*

5'UTR

chr05:26055529..26055714 (- strand) : 186 bp

CDS

chr05:26055189..26055528 (- strand) : 340 bp

chr05:26054954..26055098 (- strand) : 145 bp

chr05:26054113..26054375 (- strand) : 263 bp

chr05:26053851..26053998 (- strand) : 148 bp

chr05:26053395..26053458 (- strand) : 64 bp

chr05:26053142..26053165 (- strand) : 24 bp

3'UTR

chr05:26052916..26053141 (- strand) : 226 bp

FASTA

>Os05t0523300-01 class=Sequence position=chr05:26052916..26055714 (- strand)
ATCGTTTCCC AACTTCATAT GTAGTATATC ATTTATGGTA GAGTTTTTGA GTGTTGAAGC CCTTAACATT GGCACTGTAG
TCCTTCCTCA GCTCCACATA CCACCATCTA TTCATTTTAA CACAAAGATT TTCCTCTTGT TCCTTTTTCT TAGAGAATTC
ATATTTCCTA TAGCAGATCA AGTCCTATGG AAGAAGAATT CAAGGACAAA GGCCTCCCTC CCACGCTGCT ACACCTCATC
CCTGACGGGA GAGAATGGAA GGTGAAAGAA GCAGATGGAG AAGGATCAAG GAACACAAAC TTAGATGCCG ATGAGGATAA
GGAGCTAGAG CTTAAGCTCG GCCTCCCTGG TGTCCAACAG GAAGAGAGAG CAGCTGATTC AAGAGAGAAG ATACAGCAGC
AACAACGAGA GAGTTCCTCA GAACCATCCA TCGGTTGCTT CCCTACACAT TCAAAGCCTA CCACCAGCAT CGGCACAACT
GGGGCAAAGA GAGGATTTTT TGCGATTGTT GGGGCCACAC TAGAAGGTAG GACAAGGGAA AACGAGCAGC TTACTCTAGT
TCCTTAATTT GAGCAGCTGT TCTTTTTTTT CTATATCTTC TCTTCTGTTA CCTCAGGTTA TAATCAGAGC CACCGGGACA
CAGAAGAATG TGGGAAGGAG CTAACGTTAG GAGATGAAAA TATGGCAGGT GAGAGGAAGA AAGGATGCTG TCCCTCACCA
CCATGCTCAG CTGCAGCGCA CAGCAGCAAC CCCCAGGGGA GGTAACAATA CACTTACTGC CTTTTATCCT CTTTTCTACC
ATGGAAGCCA TACTTGTTTT TTTCTTGTCA TCATGCATGG TGACAGCATG GGTAACTTTG ACAGATTACA TATTTTTAAT
GTTAGTTCAT GCTTTCCTAT GAATTCAGCT TTCCTAGGGT CCCTTCTTTT CTTTTCTTTT TAATTCTAAA ATGAGCTAAG
ATCTTTCAAA TTGTTCCACT TGTTGGTCAT GGCTTTCTGA ATAAATTGTC GTGAGCATTT TGTGATATTT ATTTTGGCTT
TTGATACTTA GAATGATGGT TTAATCGTCA ATTTTGCCAC TCAAAGGAGA AACCTTAGTC AATTTAAATT GCCAAAAGGT
TGTCTTTTAA TCAACCACGT AGTTACTTTC TGTGGCTAGT ACTCATTGTG GCTCAAACCA TTGTTTATTG GTTAAGTAAT
GATATGCTTT CCATCAGTGG AACAGTGTGT TCTTTTAATT ATGGGTTTAT GATTTACGCC ACCTACATAC GCAGACTCCC
AATTTTTCCA AAAATAAATG AATAAACCCA TCATTTACCA GTGCTTTAAT TTGATGTAGA GGTGCTATTC CTCCAGTAGT
CGGTTGGCCT CCAATCCGGT CCTTCAGGAG AAACCTCACA AATGGCAGTT CATTTAAACA GTCCCCTGAA CGACAAAATG
ACGAAGCTGA TGACAAGGCA AAGCCAATCT GCAAGAAGAG ACCTCTTGTC AAAATCAACA TGGATGGGAT CCCCATTGGA
AGGAAAGTAG ACCTTCAAAT ATACGACAGC TACCAGAAGC TGTCATCTGC TGTTGAAGAG TTGTTCCGTG GTTTTCTTGA
AGGTAAAAAA AAAAAGAACA CCAAGCCCAC TGAACACAAA TACTTTAAGT CATTTAAGGA GCCAAATACT TTTGTTTTAA
ATGGTCTGTA TATTGTTCTA AAGCATTGTT TTGCAGCTCA AAAAGATCTA TCTTGTGCTG AAAGTGGAGA GCAAGGGGCA
GAAGACAAAA TATTTTCAGG GTTGTTGGAT GGAACTGGTG TATACACTTT AGTATATGAA GACAATGATG GAGACAGAAT
GTTAGCTGGG GACATACCAT GGAAGTAAGC TTTTGTTGTT GCTTACTCCT ACTGTATATT TATTAGCACT AGCCATATAC
AAGATACGGT GTCAGCCTGT CATACTGATT TGTTTCgggc ctgtttggat tgatgcccca gcaaaatttt ggtagtgcca
aatcttgggt aagttttggc actaccaaaa ctttggtagg gtaaagttaa aaaatgttta tttggattga agccaaACTA
TGCCCATAAG AGACTAGTTC ATGAGCAAAG CCAAATTTGT AGCGAAGGTA GTGTTTAATA CAGATGTTTG GTTTGCTACC
CTACCAAAGT TTTGGTAAGG TAGCAAATTC AAACTAGCCC GAAGGATGTG CCGTGAATAC TGCTATCTAT CTAACTAATG
CTTTTGACTG CTGCAGGGTA TTTGTTTCGA CTGTTAAGAG GTTGAGGGTT ATGAGGAGGT CAGAACTTCC CCATGACATG
GTAAGCATAG GGCAACTTCA ACAGGCGCCA TTTTCCTCAT AAATAGCAGT ACTGTATCTC TGGTTAAACT TGGATCAAAT
GGATGCACTT TTGTGTTATA TAACACCATG CTATAGTATT GCACTTATAT TAGTTATATA AAATAATTCT ATAGACTTGG
GTCAAATGGA TTCACTTCCT CAAGTTAAGG TCTGCCCTCA ATTTGTTTTC CTCTTATGTC CTTCCACAGA TTGGAGCTGA
CCCTGTGAAG TAGCAAATCG TTGATATTAG GGTCCAGACA TATCAATTGT GCAAACCATA GTCCATCACC TTTCTGGGGG
ATGACCTGTT TTTGGCTTGT ACAGATGATT ATGATAATGG GAAAATAGCA TCTTGCAGGT GCAGTGGACA AACTGCATAT
TTTGTAAATG ACCTACTCTT TTTCAGATAT AACAGATTGG TGTAATTCTA TAAGTTATAG ATTTCTTGAC AAAGGTGCC

Locus: Os05g0523300

Loading...

Locus: Os05g0523300

Loading...