Os05t0528500-00

Locus

Os05g0528500

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY58

CGSNL Gene Name

WRKY GENE 58

Oryzabase Gene Symbol Synonym(s)

OsWRKY58

Oryzabase Gene Name Synonym(s)

Rice WRKY gene58

Transcript Evidence

ab initio prediction

Protein Evidence

Q6IEM3 (UniProt)

Literature

Rice WRKY Working Group 2012. Rice 5:3.

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Expression Databases

TENOR (Os05t0528500-00)

Others

Oryzabase (6572)

Transcript

447 bp

>Os05t0528500-00 Conserved hypothetical protein.
ATGGACGGACTAGAGGCGGCGGCGGGCGATCAGCAGCACGGGCGCCTGCTGATTCCTCAG
CTGCCGGCCGCCTACCTCGCGTCGTCGTCGATGGCGGCGCTTAGCCCTGCGGGGGACGAC
TGGGCGGCGTCGCTGATCCTCCCAGATGGGGGGTCGGCGGCGGCGGGCGTGGGCGAGGAT
GATCTTGGCGGAGGAGTGATGGCGGCGGCGGCGGCGGAAAGCAGCTGCGGAGGGAGCAGC
ACCGTCACGAGCAGTGGCGTTACGGAGGCGGCGGCGGCGGCGGCGACGACCACGCGGCGT
GGGAGGGGCAACGGGAAGAAGGCGGGCGGCGGCGGGAGGACGCCGAGTTACCTTAACCTG
GCACTGGATTTAGGAGCGCAAAAGAGGGAGGAGGGGCAACCTTCCGGTGAAGATTACGAC
GACGGGCCATCTTCTCTTCAATTATAG

CDS

447 bp

>Os05t0528500-00 Conserved hypothetical protein.
ATGGACGGACTAGAGGCGGCGGCGGGCGATCAGCAGCACGGGCGCCTGCTGATTCCTCAG
CTGCCGGCCGCCTACCTCGCGTCGTCGTCGATGGCGGCGCTTAGCCCTGCGGGGGACGAC
TGGGCGGCGTCGCTGATCCTCCCAGATGGGGGGTCGGCGGCGGCGGGCGTGGGCGAGGAT
GATCTTGGCGGAGGAGTGATGGCGGCGGCGGCGGCGGAAAGCAGCTGCGGAGGGAGCAGC
ACCGTCACGAGCAGTGGCGTTACGGAGGCGGCGGCGGCGGCGGCGACGACCACGCGGCGT
GGGAGGGGCAACGGGAAGAAGGCGGGCGGCGGCGGGAGGACGCCGAGTTACCTTAACCTG
GCACTGGATTTAGGAGCGCAAAAGAGGGAGGAGGGGCAACCTTCCGGTGAAGATTACGAC
GACGGGCCATCTTCTCTTCAATTATAG

Protein

149 aa

>Os05t0528500-00 Conserved hypothetical protein.
MDGLEAAAGDQQHGRLLIPQLPAAYLASSSMAALSPAGDDWAASLILPDGGSAAAGVGED
DLGGGVMAAAAAESSCGGSSTVTSSGVTEAAAAAATTTRRGRGNGKKAGGGGRTPSYLNL
ALDLGAQKREEGQPSGEDYDDGPSSLQL*

CDS

chr05:26257463..26257809 (- strand) : 347 bp

chr05:26257051..26257150 (- strand) : 100 bp

FASTA

>Os05t0528500-00 class=Sequence position=chr05:26257051..26257809 (- strand)
ATGGACGGAC TAGAGGCGGC GGCGGGCGAT CAGCAGCACG GGCGCCTGCT GATTCCTCAG CTGCCGGCCG CCTACCTCGC
GTCGTCGTCG ATGGCGGCGC TTAGCCCTGC GGGGGACGAC TGGGCGGCGT CGCTGATCCT CCCAGATGGG GGGTCGGCGG
CGGCGGGCGT GGGCGAGGAT GATCTTGGCG GAGGAGTGAT GGCGGCGGCG GCGGCGGAAA GCAGCTGCGG AGGGAGCAGC
ACCGTCACGA GCAGTGGCGT TACGGAGGCG GCGGCGGCGG CGGCGACGAC CACGCGGCGT GGGAGGGGCA ACGGGAAGAA
GGCGGGCGGC GGCGGGAGGA CGCCGAGGTT CGCGTTCCAC ACGAGGAGCG AGAACGACAT cctcgacgac ggctaccggt
ggaggaagta cgggcagaag gccgtcaaga acagcgactt ccccaggTAT ATTATATATA CATTGCGTTC TTAATTTCTA
GCTAGCGGCT AACGTGTACA GGGCCTACAG GCTACTCATG CATGATATAT ATTGCATGAA TCCATTCATG GCTTGTGCAT
CTACACGTAC GTATGGACAA TATTGACGTT GAAAATGCAT TAATTAATGG GGCTACTATA CCTAGAAGGC TAGAACAAAG
GAATTGCTAT GAATTTTAGT TACCTTAACC TGGCACTGGA TTTAGGAGCG CAAAAGAGGG AGGAGGGGCA ACCTTCCGGT
GAAGATTACG ACGACGGGCC ATCTTCTCTT CAATTATAG

Locus: Os05g0528500

Loading...

Locus: Os05g0528500

Loading...