Os05t0533600-01

Locus

Os05g0533600

Description

Starch synthase, Starch biosynthesis

RAP-DB Gene Symbol Synonym(s)

SSIVB, OsSSIVb, SSIV-2, OsSSIV-2, SSIVb, SSIV-2

RAP-DB Gene Name Synonym(s)

SOLUBLE STARCH SYNTHASE IVB, SOLUBLE STARCH SYNTHASE IV-2

CGSNL Gene Symbol

SSIVB

CGSNL Gene Name

SOLUBLE STARCH SYNTHASE IVB

Oryzabase Gene Symbol Synonym(s)

OsSSIVb, SSIV-2, OsSSIV-2, SSIVb, SSIV-2

Oryzabase Gene Name Synonym(s)

SOLUBLE STARCH SYNTHASE IV-2

Transcript Evidence

AY373258

AK067577

Protein Evidence

Q84VC7

Literature

PMID: 15232694

PMID: 15642712

PMID: 21595523

Note

Manual Curation

March 2, 2010

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Biological Process: glucan biosynthetic process (GO:0009250)

Molecular Function: starch synthase activity (GO:0009011)

Functional domain (InterPro)

Glycogen/starch synthase, ADP-glucose type (IPR011835)

Starch synthase, catalytic domain (IPR013534)

Glycosyl transferase, family 1 (IPR001296)

Full-length cDNA

J013110M10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0533600-01)

RiceXPro (AK067577)

Others

Oryzabase (8107)

KEGG (Os05t0533600-01)

Transcript

3279 bp

>Os05t0533600-01 Starch synthase, Starch biosynthesis
ACTCCGCTACTTTTTCCAACCGTCGCCCCACGCGAACCCCGACGCCGCGCCCCCCTTCCC
CAGCCTCCGCATCCGATTCCCATGGCGTGCTTGGCGGCGGGCGCCGAGGCGGCCCCTCTC
CTCTTCCGGCGGCGGCTAGCGCCGTCCCCAGTCGCCGCGCGCCGCCGCCTTCTCGTGTCG
TGCCGAGCTCGCCGCCGCGGTCTCAGGACTGCTGCAGAACTTCCTCGGAAGAGTACAAGT
AATGATAAACACCATAATAGGGTGAATATGCAGAGAGATGAAGCATCTGTTTCCAGTGAT
AAAGAACGGCAAGAGAAATATGGAGATGAAAATGGTATATCAAACCTTCAATTGGAAGAT
TTGATACAAATGATACAAAACACTGAGAAGAATATAATGCTTCTGAATCAAGCTCGTCTT
CAAGCATTGGAACATGTTGAAACAGTTCTTAAAGAAAAAGAAGACTTACAGAGGAAGTTG
AAAATTTTGGAGACGAGATTGTCAGAAACAGATGCACGGCTTAAGCTTTCAGCTGAAGGG
CAGTTCGGTACTGAGATTAATGACTCTCTACCAGTACTGGAATTAGATGATATAAAGGAA
GAGAATATGCTACTGAAGGATGACATACAATTTCTGAAAACAATGCTTATTGAGGTTGCT
GAGACAGAGAACAGTATATTCACATTAGAGAAGGAGCGTGCTCTTTTAGATGCTTCGCTT
AGGGAGCTGGAGTCTAGATTTATAGATGCCCAAGCAGATATGTTGAAGTCTGATCCTAGG
CAGTATGATGCATGGTGGGAGAAAGTAGAAAATTTGGGGGACTTGCTTGAGACTGCAACA
AACAAAGTAGAGAATGCTGCTATGGTTCTGGGACGCAATCATGATTTGGAAGATAAGGTC
GACAAACTAGAGGCATCGTTGGCTGAAGCAAATATATCAAAGTTCTCTTGTTATTTTGTT
GATCTTTTGCAGGAAAAGATAAAATCAGTAGAAGAGCGCTTCCAAGTATGTAATCATGAA
ATGCATTCTCAAATTGAACTCTATGAGAATTCAATAGCGGAATTTCACGATATTCTTAGC
AAGCTAGTGGAGGAAACTGAGAAACGATCACTAGAGCATTCAGCAAGTAGCATGCCTTCA
GAATTGTGGAGTAGGATATCTCTTCTGATTGATGGTTGGTTGCTCGAGAAGAGAATATCC
TACAATGATGCAAATACATTACGGGAAATGGTCAGGAAAAGGGATAGTTGTCTTCGGGAA
GCATACTTGTCATGCAGAGGTATGAAAGATAGGGAAATTGTGGACAATTTTCTAAAGATC
ACATTGCCAGGGACTAGTTCTGGCTTGCACATCATCCACATAGCAGCAGAGATGGCTCCT
GTTGCAAAGGTTGGTGGTTTGGCGGATGTGATATCTGGTCTTGGCAAGGCACTTCAGAAA
AAGGGCCACCTAGTAGAGATTATTCTTCCAAAATATGACTGCATGCAGAATGACCAAGTT
AATAACCTTAAGGTTTTAGATGTTGTTGTACAATCCTACTTTGAAGGAAATTTGTTCAAC
AACAAAATATGGACTGGGACTGTTGAAGGCCTTCCAGTCTATTTTATCGAGCCACAACAT
CCAGCAAAATTCTTTTGGAGGGCACAATACTATGGAGAACACGATGACTTTAAACGTTTT
GCATACTTCAGCCGTGCAGCACTGGAATTACTTTACCAATCGCAGAAGAAAATTGACATC
ATCCATTGCCATGACTGGCAGACTGCATTTGTGGCACCTCTTTATTGGGAAGCATATGCA
AATCTGGGCTTCAACTCAGCTAGAATTTGCTTCACCTGCCATAATTTTGAATATCAAGGA
GCTGCTCCTGCTCAAGATTTAGCATGCTGTGGCCTTGATGTTCAGCAACTTGATAGGGAA
GACAGGATGCGGGACAATTCACATGGCAGAATAAATGTTGTCAAGGGTGCAATTGTGTAT
TCCAACATTGTGACAACTGTATCACCAACATATGCACTAGAGGTGCGATCAGAGGGTGGA
CGTGGACTACAAGATTCACTCAAATTACATTCCAGGAAATTTGTTGGGATACTTAATGGA
ATCGACACAGACACATGGAATCCTTCAACAGATAGACATCTCAAGGTTCAATATAATGCT
AATGATCTCCAGGGTAAGGCAGCAAACAAAGCAGCTCTCAGAAAGCAGCTAAACTTATCT
TCTACAAATGCTTCTCAACCACTGGTTGGGTGTATTACAAGGCTAGTTCCTCAAAAGGGT
GTACATCTCATCAGGCATGCAATATACAAAACAGCTGAGCTAGGAGGACAGTTTGTTCTT
CTGGGCTCAAGTCCAGTACCACACATTCAAAGAGAGTTTGAGGGTATTGCAGACCATTTT
CAGAACAATAACAATATCCGACTGCTTTTGAAGTATGATGATTCTTTATCCCATTGGATT
TATGCAGCATCTGACATGTTCATTGTTCCATCCATGTTTGAGCCATGTGGCCTCACACAG
ATGATTGCCATGAGATATGGTTCTGTGCCGATTGTTCGGAAAACCGGTGGATTGAATGAC
AGTGTCTTCGATTTCGACGACGAAACGATACCTAAGGAGCTGCGGAATGGCTTTACGTTT
GTGCATCCTGATGAAAAGGCTCTAAGTGGTGCAATGGAGAGAGCGTTCAACTACTACAAT
AGAAAGCCTGAGGTCTGGAAACAGCTGGTGCAGAAGGACATGAGGATAGATTTCAGCTGG
GCCTCTTCAGCTTCCCAGTACGAAGATATCTATCAAAGAGCAGTGGCTCGAGCGAGGGCA
GCAGCATGAACTCTGGCGGTTTAGTGAGACCTGAGCCTTTCTCTGACGCGGCGCTTGATG
CCACAGGCACAGATTCTGCCTTCTGAAGAAGCCGCACCATGCACCTCTCTGATGTGCGAA
CATGGCTTCATCTGCAGCTTCGATTCTTGGAATGGAACCCAAGATATTTAAAGACATGAT
CCGTCAGACTCATGCAGGAAGCCGAGATGTTCCATAGTGCAGTTATGGAATGGTCGAAGA
ACTAAAATCTTGGCACCCATTGTCGTGTCCCAGTGACAGTGTGGACTATACAGTTATATA
ACTTATAGTACGTGATTGCTCAGTCGTGAAATTTCACTAGCCTCGATATATTTATCATGC
GCTACGGTGAAATGATAAGTTTTGTTCTTTGTATCACTTGCAGTGTGCTTTGTTATTTGT
GCAAAGTCGTGTGTGTTGTCTATAGAATATTCTTTCGTC

CDS

2748 bp

>Os05t0533600-01 Starch synthase, Starch biosynthesis
ATGGCGTGCTTGGCGGCGGGCGCCGAGGCGGCCCCTCTCCTCTTCCGGCGGCGGCTAGCG
CCGTCCCCAGTCGCCGCGCGCCGCCGCCTTCTCGTGTCGTGCCGAGCTCGCCGCCGCGGT
CTCAGGACTGCTGCAGAACTTCCTCGGAAGAGTACAAGTAATGATAAACACCATAATAGG
GTGAATATGCAGAGAGATGAAGCATCTGTTTCCAGTGATAAAGAACGGCAAGAGAAATAT
GGAGATGAAAATGGTATATCAAACCTTCAATTGGAAGATTTGATACAAATGATACAAAAC
ACTGAGAAGAATATAATGCTTCTGAATCAAGCTCGTCTTCAAGCATTGGAACATGTTGAA
ACAGTTCTTAAAGAAAAAGAAGACTTACAGAGGAAGTTGAAAATTTTGGAGACGAGATTG
TCAGAAACAGATGCACGGCTTAAGCTTTCAGCTGAAGGGCAGTTCGGTACTGAGATTAAT
GACTCTCTACCAGTACTGGAATTAGATGATATAAAGGAAGAGAATATGCTACTGAAGGAT
GACATACAATTTCTGAAAACAATGCTTATTGAGGTTGCTGAGACAGAGAACAGTATATTC
ACATTAGAGAAGGAGCGTGCTCTTTTAGATGCTTCGCTTAGGGAGCTGGAGTCTAGATTT
ATAGATGCCCAAGCAGATATGTTGAAGTCTGATCCTAGGCAGTATGATGCATGGTGGGAG
AAAGTAGAAAATTTGGGGGACTTGCTTGAGACTGCAACAAACAAAGTAGAGAATGCTGCT
ATGGTTCTGGGACGCAATCATGATTTGGAAGATAAGGTCGACAAACTAGAGGCATCGTTG
GCTGAAGCAAATATATCAAAGTTCTCTTGTTATTTTGTTGATCTTTTGCAGGAAAAGATA
AAATCAGTAGAAGAGCGCTTCCAAGTATGTAATCATGAAATGCATTCTCAAATTGAACTC
TATGAGAATTCAATAGCGGAATTTCACGATATTCTTAGCAAGCTAGTGGAGGAAACTGAG
AAACGATCACTAGAGCATTCAGCAAGTAGCATGCCTTCAGAATTGTGGAGTAGGATATCT
CTTCTGATTGATGGTTGGTTGCTCGAGAAGAGAATATCCTACAATGATGCAAATACATTA
CGGGAAATGGTCAGGAAAAGGGATAGTTGTCTTCGGGAAGCATACTTGTCATGCAGAGGT
ATGAAAGATAGGGAAATTGTGGACAATTTTCTAAAGATCACATTGCCAGGGACTAGTTCT
GGCTTGCACATCATCCACATAGCAGCAGAGATGGCTCCTGTTGCAAAGGTTGGTGGTTTG
GCGGATGTGATATCTGGTCTTGGCAAGGCACTTCAGAAAAAGGGCCACCTAGTAGAGATT
ATTCTTCCAAAATATGACTGCATGCAGAATGACCAAGTTAATAACCTTAAGGTTTTAGAT
GTTGTTGTACAATCCTACTTTGAAGGAAATTTGTTCAACAACAAAATATGGACTGGGACT
GTTGAAGGCCTTCCAGTCTATTTTATCGAGCCACAACATCCAGCAAAATTCTTTTGGAGG
GCACAATACTATGGAGAACACGATGACTTTAAACGTTTTGCATACTTCAGCCGTGCAGCA
CTGGAATTACTTTACCAATCGCAGAAGAAAATTGACATCATCCATTGCCATGACTGGCAG
ACTGCATTTGTGGCACCTCTTTATTGGGAAGCATATGCAAATCTGGGCTTCAACTCAGCT
AGAATTTGCTTCACCTGCCATAATTTTGAATATCAAGGAGCTGCTCCTGCTCAAGATTTA
GCATGCTGTGGCCTTGATGTTCAGCAACTTGATAGGGAAGACAGGATGCGGGACAATTCA
CATGGCAGAATAAATGTTGTCAAGGGTGCAATTGTGTATTCCAACATTGTGACAACTGTA
TCACCAACATATGCACTAGAGGTGCGATCAGAGGGTGGACGTGGACTACAAGATTCACTC
AAATTACATTCCAGGAAATTTGTTGGGATACTTAATGGAATCGACACAGACACATGGAAT
CCTTCAACAGATAGACATCTCAAGGTTCAATATAATGCTAATGATCTCCAGGGTAAGGCA
GCAAACAAAGCAGCTCTCAGAAAGCAGCTAAACTTATCTTCTACAAATGCTTCTCAACCA
CTGGTTGGGTGTATTACAAGGCTAGTTCCTCAAAAGGGTGTACATCTCATCAGGCATGCA
ATATACAAAACAGCTGAGCTAGGAGGACAGTTTGTTCTTCTGGGCTCAAGTCCAGTACCA
CACATTCAAAGAGAGTTTGAGGGTATTGCAGACCATTTTCAGAACAATAACAATATCCGA
CTGCTTTTGAAGTATGATGATTCTTTATCCCATTGGATTTATGCAGCATCTGACATGTTC
ATTGTTCCATCCATGTTTGAGCCATGTGGCCTCACACAGATGATTGCCATGAGATATGGT
TCTGTGCCGATTGTTCGGAAAACCGGTGGATTGAATGACAGTGTCTTCGATTTCGACGAC
GAAACGATACCTAAGGAGCTGCGGAATGGCTTTACGTTTGTGCATCCTGATGAAAAGGCT
CTAAGTGGTGCAATGGAGAGAGCGTTCAACTACTACAATAGAAAGCCTGAGGTCTGGAAA
CAGCTGGTGCAGAAGGACATGAGGATAGATTTCAGCTGGGCCTCTTCAGCTTCCCAGTAC
GAAGATATCTATCAAAGAGCAGTGGCTCGAGCGAGGGCAGCAGCATGA

Protein

915 aa

>Os05t0533600-01 Starch synthase, Starch biosynthesis
MACLAAGAEAAPLLFRRRLAPSPVAARRRLLVSCRARRRGLRTAAELPRKSTSNDKHHNR
VNMQRDEASVSSDKERQEKYGDENGISNLQLEDLIQMIQNTEKNIMLLNQARLQALEHVE
TVLKEKEDLQRKLKILETRLSETDARLKLSAEGQFGTEINDSLPVLELDDIKEENMLLKD
DIQFLKTMLIEVAETENSIFTLEKERALLDASLRELESRFIDAQADMLKSDPRQYDAWWE
KVENLGDLLETATNKVENAAMVLGRNHDLEDKVDKLEASLAEANISKFSCYFVDLLQEKI
KSVEERFQVCNHEMHSQIELYENSIAEFHDILSKLVEETEKRSLEHSASSMPSELWSRIS
LLIDGWLLEKRISYNDANTLREMVRKRDSCLREAYLSCRGMKDREIVDNFLKITLPGTSS
GLHIIHIAAEMAPVAKVGGLADVISGLGKALQKKGHLVEIILPKYDCMQNDQVNNLKVLD
VVVQSYFEGNLFNNKIWTGTVEGLPVYFIEPQHPAKFFWRAQYYGEHDDFKRFAYFSRAA
LELLYQSQKKIDIIHCHDWQTAFVAPLYWEAYANLGFNSARICFTCHNFEYQGAAPAQDL
ACCGLDVQQLDREDRMRDNSHGRINVVKGAIVYSNIVTTVSPTYALEVRSEGGRGLQDSL
KLHSRKFVGILNGIDTDTWNPSTDRHLKVQYNANDLQGKAANKAALRKQLNLSSTNASQP
LVGCITRLVPQKGVHLIRHAIYKTAELGGQFVLLGSSPVPHIQREFEGIADHFQNNNNIR
LLLKYDDSLSHWIYAASDMFIVPSMFEPCGLTQMIAMRYGSVPIVRKTGGLNDSVFDFDD
ETIPKELRNGFTFVHPDEKALSGAMERAFNYYNRKPEVWKQLVQKDMRIDFSWASSASQY
EDIYQRAVARARAAA*

5'UTR

chr05:26485812..26485892 (+ strand) : 81 bp

CDS

chr05:26485893..26486017 (+ strand) : 125 bp

chr05:26486513..26486621 (+ strand) : 109 bp

chr05:26487150..26487225 (+ strand) : 76 bp

chr05:26487315..26488260 (+ strand) : 946 bp

chr05:26488352..26488403 (+ strand) : 52 bp

chr05:26488733..26488855 (+ strand) : 123 bp

chr05:26488932..26489007 (+ strand) : 76 bp

chr05:26489096..26489280 (+ strand) : 185 bp

chr05:26489403..26489594 (+ strand) : 192 bp

chr05:26489683..26489751 (+ strand) : 69 bp

chr05:26490533..26490742 (+ strand) : 210 bp

chr05:26491021..26491146 (+ strand) : 126 bp

chr05:26492390..26492539 (+ strand) : 150 bp

chr05:26493071..26493132 (+ strand) : 62 bp

chr05:26493216..26493291 (+ strand) : 76 bp

chr05:26493363..26493533 (+ strand) : 171 bp

3'UTR

chr05:26493534..26493983 (+ strand) : 450 bp

FASTA

>Os05t0533600-01 class=Sequence position=chr05:26485812..26493983 (+ strand)
ACTCCGCTAC TTTTTCCAAC CGTCGCCCCA CGCGAACCCC GACGCCGCGC CCCCCTTCCC CAGCCTCCGC ATCCGATTCC
CATGGCGTGC TTGGCGGCGG GCGCCGAGGC GGCCCCTCTC CTCTTCCGGC GGCGGCTAGC GCCGTCCCCA GTCGCCGCGC
GCCGCCGCCT TCTCGTGTCG TGCCGAGCTC GCCGCCGCGG TCTCAGGTTG GTAGCCCAGA GCGCAGGATC GCGTGGTTGC
GGCGTGGTCG GTGCACCCGG TTGTGATTAC TGGTGTGTTG CGTGGTCTCG TTCGTTCGTT CTCAGTAGTC TGCTCCTGCG
GCGAACCGGG GGAATGGCCT TTTGGGGTTT GGGTTGGGTT GGGTTGGGTT GGGTGACAGG GGATCGAGGA ATTCAATTCC
CTTGGTGGTG CGTGCTTGTA TGCATAGAAT GCTTCGATCG TGACCAAGTG GGGATCATCA ACCTCTGAAT GCTGCTCTCC
TAATATTGTT TGGCTTAGGT TCTGAAATGC TTCTTAATCA CCGGAATGTT CCACCTATCT GAGAAAATAT CCTAGCTTAT
GTTGTGTAAT CATGATCATT GATCAAATCA TCAGAAATCG ATACTGTCGG AACGCTTTAT ATTTGTACAT TTTTGTTGTT
TTGATTCATA GAATATGTCA AGAAATTCTG TTAAGCTTAG CTTCATTTTT GCGGGTTCTA GGACTGCTGC AGAACTTCCT
CGGAAGAGTA CAAGTAATGA TAAACACCAT AATAGGGTGA ATATGCAGAG AGATGAAGCA TCTGTTTCCA GTGATAAAGA
ACGGCAAGAG GTACCACAGC ACATTCATTA GCAATTTCAT ATGTTTTCCG ATTTTGTGAG ATTGATATAA TATTTGGGCC
AATTTCACGA TACTATGTAT GTGGTGTAGA TTGAAGTCCC CAAACACTCA ATATCCCCCT TTTAATACAA TTTTCTGTGT
TTTTATATTA TTTTTACATA AGAAACTGAA GTGAAACACA TTGTCACTAA ACTAGCTAAA CAATTTAATA TCCAAAGGCA
ATACCTGATA TTGGCAGGCT ATCTTCACAG AAAAATGCCG GGTCGGCCAA AGGTTGGCCG ACCAATTTCT TAAGATTGGG
GAGAAAAACA AAGGAATGTT ACAGCGACAT TACAATGTCG CGCTAGTCCG GGAGAGATCC CAGACACAGC GTGAACAAGC
GAAAGAGAAA GAGACACCAT GGATGCAGTA GTTATCATGA AGTTACTGTT TGCGTCAATT TCGTCTTTAT TTTTATGTAT
GCTCCTACTT GTTCACTGTT GCTTCTTTTA ATATTTTGGG CTTTGTGTGT TTCAACAGAA ATATGGAGAT GAAAATGGTA
TATCAAACCT TCAATTGGAA GATTTGATAC AAATGATACA AAACACTGAG AAGAGTAAGG GGCTCCTTTC TTTTGGATAA
ATGATATTTA TAATGTTGTA GGCATGCACA TAATAATCAT TATCTTCAAA CGTATTTGTT TAGATATAAT GCTTCTGAAT
CAAGCTCGTC TTCAAGCATT GGAACATGTT GAAACAGTTC TTAAAGAAAA AGAAGACTTA CAGAGGAAGT TGAAAATTTT
GGAGACGAGA TTGTCAGAAA CAGATGCACG GCTTAAGCTT TCAGCTGAAG GGCAGTTCGG TACTGAGATT AATGACTCTC
TACCAGTACT GGAATTAGAT GATATAAAGG AAGAGAATAT GCTACTGAAG GATGACATAC AATTTCTGAA AACAATGCTT
ATTGAGGTTG CTGAGACAGA GAACAGTATA TTCACATTAG AGAAGGAGCG TGCTCTTTTA GATGCTTCGC TTAGGGAGCT
GGAGTCTAGA TTTATAGATG CCCAAGCAGA TATGTTGAAG TCTGATCCTA GGCAGTATGA TGCATGGTGG GAGAAAGTAG
AAAATTTGGG GGACTTGCTT GAGACTGCAA CAAACAAAGT AGAGAATGCT GCTATGGTTC TGGGACGCAA TCATGATTTG
GAAGATAAGG TCGACAAACT AGAGGCATCG TTGGCTGAAG CAAATATATC AAAGTTCTCT TGTTATTTTG TTGATCTTTT
GCAGGAAAAG ATAAAATCAG TAGAAGAGCG CTTCCAAGTA TGTAATCATG AAATGCATTC TCAAATTGAA CTCTATGAGA
ATTCAATAGC GGAATTTCAC GATATTCTTA GCAAGCTAGT GGAGGAAACT GAGAAACGAT CACTAGAGCA TTCAGCAAGT
AGCATGCCTT CAGAATTGTG GAGTAGGATA TCTCTTCTGA TTGATGGTTG GTTGCTCGAG AAGAGAATAT CCTACAATGA
TGCAAATACA TTACGGGAAA TGGTCAGGAA AAGGGATAGT TGTCTTCGGG AAGCATACTT GTCATGCAGA GGTATGAAAG
ATAGGGAAAT TGTGGACAAT TTTCTAAAGA TCACATTGCC AGGGACTAGG TACACTTTCT CCTTTGCTAG TAGGAGTAAA
GCCTGTTTAT AGGATAATAC TCTGTCTTTA TTTAGTTTTA CAATTTATTG ATTAATGTAG TTCTGGCTTG CACATCATCC
ACATAGCAGC AGAGATGGCT CCTGTTGCAA AGGTGATCCT TGGTACTCCC TTCAACCTTT CATCACGTGC ATTTCATTTC
ATTACTACTC CTGACACAAA TACATTTCTA GTTAGTATAT TTTGATATGG TTCTGCTGAT TAGATGTGAA ACTACTGATG
TGATAGTTGA CTAAGGGTCT AATTGGTAGC CTGGGCTGCG GCTGTGCTGC AGTCAGCTGC TACAGTCCCT TGCATGCAGC
ATGGCCCACT GCTGCTGCTG AGGCTGCAGC TGTAGTTTTG GAATTTGATT TGTTGTTAAT GCTGATTAAT TGAAATCCTA
TCAGTTACTC TTTAAGTTTG CTTATATGCA TGATTCTTTA GGTTGGTGGT TTGGCGGATG TGATATCTGG TCTTGGCAAG
GCACTTCAGA AAAAGGGCCA CCTAGTAGAG ATTATTCTTC CAAAATATGA CTGCATGCAG AATGACCAAG TTAATAACCT
TAAGGTATAT AGTTTGTTTC TCACCGAAGT TTTTGGTCGC TTCTTTTGTT TGTTTAAGAT TTTATTTTTC TATCATGCAG
GTTTTAGATG TTGTTGTACA ATCCTACTTT GAAGGAAATT TGTTCAACAA CAAAATATGG ACTGGGACTG TTGAAGGTTT
GAAGCATCCC TCAGTTCGAC CTTTCTGTAA AATTAAGTCA TAACATTGAA TCTTCATCGA CCTGACTAAA TTTAGCATAT
GCAGGCCTTC CAGTCTATTT TATCGAGCCA CAACATCCAG CAAAATTCTT TTGGAGGGCA CAATACTATG GAGAACACGA
TGACTTTAAA CGTTTTGCAT ACTTCAGCCG TGCAGCACTG GAATTACTTT ACCAATCGCA GAAGAAAATT GACATCATCC
ATTGCCATGA CTGGCAGACT GCATTTGTGG TACGTGTCAA ATGCACTTGG CTGTATTGGC TAATTGACCA CTGAAAATGG
ATCATGCTCT TCTTGGTTGA TTTGCCAAGT TAAAGATATT AATTTGCTCA TCTTTTACTT TGAAATTCCA GGCACCTCTT
TATTGGGAAG CATATGCAAA TCTGGGCTTC AACTCAGCTA GAATTTGCTT CACCTGCCAT AATTTTGAAT ATCAAGGAGC
TGCTCCTGCT CAAGATTTAG CATGCTGTGG CCTTGATGTT CAGCAACTTG ATAGGGAAGA CAGGATGCGG GACAATTCAC
ATGGCAGAAT AAATGTTGTC AAGGTACTGA CCATTGAAAC CGTGCAATAG ATTGAATTCA AATTTCACCT GTATGATACC
AACAAGGTTG TTTTGGGTTC ATTGTTTTCA GGGTGCAATT GTGTATTCCA ACATTGTGAC AACTGTATCA CCAACATATG
CACTAGAGGT GCGATCAGAG GTAATTTTCT TGTAACTTTA GTTGTGTGTA TTTGATTAAC TTTAGTTTCA GTAGTACCTT
CTAATGGCGA GATTAGTGTT TCTCAAAATT TATATACCAG TTTTTTTTTT TTGTGTGTGT GCATGTGTTT TATGTGTGTG
TGTGTGTGGT GGGGTGGGGG TGGGGGGGGG GGTGAGAGAA GGGAAGAAGA CCATAAGTTG ATGCACAATT CATGGGAAAC
TACCACACTA CCTTGTTGTT CATTATGCAG TTTATTTATT CCAGTGGCAT TCCTACATGA ACTGAAATAA GCTGCTGCAT
CATAACATAG GGAGTTGTTT AAGAGCTTGA CTGCTTGATA AATCCCTTTA TATGTAATGC TATACATATC ACTACATCAG
CATATCCATA GAATGCCTCA ACTATCCTGG ACTCCTGGTG TTTCTAGTTT CCATTATTCA ATATGTCTTA TACCCTATAT
TGTTACAAGt gttctaaaag cagtacacta ggcaccaggt agctgccacg attagcattt aatggtgcat taggcgtctg
cccagctttg ggggctccag tgttgctata ttaatgttct attgtctttc ttttatgtca tatgctaatt gcttggaagc
cccttgttaa gttgatccta ggcgcaccta ggcactaggc agcgtcttgc cgaccatcta acgtctagtg ccttctctga
ttagaagttc attgtaGTAG TTTCAGTTTG TAAGCGAAGT CTGTTGGCAT TCTGTTATTG ACAAGCTCTT CTGGTGCTCA
GGGTGGACGT GGACTACAAG ATTCACTCAA ATTACATTCC AGGAAATTTG TTGGGATACT TAATGGAATC GACACAGACA
CATGGAATCC TTCAACAGAT AGACATCTCA AGGTTCAATA TAATGCTAAT GATCTCCAGG GTAAGGCAGC AAACAAAGCA
GCTCTCAGAA AGCAGCTAAA CTTATCTTCT ACAAATGCTT CTCAACCACT GGTACGATTT TTAATCCCCT CATCTACTGC
TAAACTGGAT ACAGAAATTA TGACCATGTA CCTGTACTTG AATTAAGAAT TTTCCCTCTT GTCAGCTTTG CAGTTTATTT
TAGCTATCTG GTTTTATTAT ATTCCCTTTT TTTTTTCAAG TATGGTTTAC CTATGTATAT TGATAAAACA GAAGTGAAAT
ATTTACAAGG TTTATTGCTT TCTTTCATTT GTTATAGAAG TTTCGCTTTC AATTCAAGAC TAACTACACA CTAAAGTTTC
CTTGAGCAGG TTGGGTGTAT TACAAGGCTA GTTCCTCAAA AGGGTGTACA TCTCATCAGG CATGCAATAT ACAAAACAGC
TGAGCTAGGA GGACAGTTTG TTCTTCTGGG CTCAAGTCCA GTACCACACA TTCAAGTACA TTTTCTTCTG AACTATAGTA
GGGTCAGCTA ACATGATCAT ATTTGAATGT AGAGAAAAGG AAATAAAAAA AAAAACTTAA CTAGCTCGTG AACAATCTAT
ATATCTAAAG CTGGCGGGTC TCCCCGCCAG CTGATTGGTG GATTTTGCCA CCATCAATCT GTTGACACGT GTCCATTTCA
CATTGGCGCG CAGTAAACGG ATCCTACTAG GCTTCGCTGG TCTTGCGCAT CAGCCCACGC CGATTGGCTT GCCCCGCCTG
GACGCTCTAT TGATTTGCTG ACAGATGGGC CATCCTTAAA ATATCCTAAT TATTAATCCT CTGAAAAAAC AACTGAGATG
GGCCATCCTT AAGAGCTACG GCAGCACGGT TAGAAGTCAT TGGGAAAAAT ATATGCATGT AAAAACATGC ATGTGAAGAT
ATATACGTGC ACCAATTTGA AATAGGAAAT TTTAATATAT ATGTGTATAT ATAAGCCCTA TTTTATTATT CGTACATATG
ACAAAATTAT ACTACCGTCA CATAATAAAG GATGACAATA TCACAAAAAT AATTCTTATT CTTACGTAAA AATAACAAAT
GTATAAAAAA CAATCCAAAA TAATTTTAAT GTAAAACTGC ATACCTCTAA TCAGTAAAAA GAACAAAGAC CAAAAAATAC
AAACTATGAA AAAAGACACA AAATCAATCT AAAAATTATG TTCTAAAATT TTAAATTTTT AACAAATAGG CTATGAGAGT
GCTTACCAGT TTACAACTTC CTTTAATACT ATTAGTCCAA AGtatttcct ccagttccat aattcttgat gttttgaaaa
aaaaatgaga tcaaataatt aatttgatga cactaaaact tggtgtggtg tacagattgg ttaaaatact ttagtaaaat
taaatattga cctatttatt atttatatta ttatagaaat taatagtaaa ttatagatat atattttgag gtccatttaa
ttgtccaGGG GTACAGAGTC CCCGTCAAAT GTAGCATTTT TAATGAATCT TATATAAAAT AAATAAATTT GGGTAAAATC
TATAAAGAGA AATAGGCTAA TCAGCCGGCG TGCCAAAAGG CACGCCTATT TTCTAGTCTG TTTATATGGA TGGAGCTTGT
TTTTTATTTG AAAAATAgtt gctcttgctc cttttgttga acacctcttt acttattgtt gctatagtga acatgtttgg
tGCTAATTTA CTTTGCAGAG AGAGTTTGAG GGTATTGCAG ACCATTTTCA GAACAATAAC AATATCCGAC TGCTTTTGAA
GTATGATGAT TCTTTATCCC ATTGGATTTA TGCAGCATCT GACATGTTCA TTGTTCCATC CATGTTTGAG CCATGTGGCC
TCACACAGGT GTGCCTTTAC ATACTTATAT TACGTAGTTT GTATTAAATG TAAATACTGA AACGTGCCAT TTAGCATTAT
CCGTAATCTG TTTCTTTATT TACTATGCAC TCTATGATTG TCTTGATAAA TTATATTCCT AGATATAAAT ATGCAATGCA
AGCAATTTCT CTGATCGTAC TTCCATCTTT TTTTTCCTAT TTGGTAGAGG ATTTATTCTT GCCTTATTTT TTTTGAGGTG
TATGATATAT GATCCAATAC CTCATAATAT GATCATTGAA AACTTTTGAA CACAATTCAG AAGTACAGAG TGAGAAAAAT
AAAATGTGCC AAGATGTTTT TCCAATTAGT CAATGAAATT CTGCCCTTTA CCCTTGAAAC CCACAGTAGA ATATGTTCTC
AGATTTGAAG AATTTCATCA ACACAAAAAT AAACATGTTT CCAGAGCTTT CCAAAATTCA TGAGCACAAG CTTGCAGTTC
TGCAAAGCTG TTCTTGGTTC ATTCCTGTTG AGCAATTCTG ACATGTTCTG TATCCACAGA TGATTGCCAT GAGATATGGT
TCTGTGCCGA TTGTTCGGAA AACCGGTGGA TTGAATGACA GGTAAATAGT TATTAATTAA CCAACTATCT CCCAATATTA
TTCTCCTTAA TAATGTAAAA TGCCCCCACT CACCTGCTTT GCAGTGTCTT CGATTTCGAC GACGAAACGA TACCTAAGGA
GCTGCGGAAT GGCTTTACGT TTGTGCATCC TGATGAAAAG GTGGATGTCG TTTCAGTTCA TCTCTCCTCT TTTGGTGGAC
ACAACTCATG TGGGTGTTCC TTTTTTGACA GGCTCTAAGT GGTGCAATGG AGAGAGCGTT CAACTACTAC AATAGAAAGC
CTGAGGTCTG GAAACAGCTG GTGCAGAAGG ACATGAGGAT AGATTTCAGC TGGGCCTCTT CAGCTTCCCA GTACGAAGAT
ATCTATCAAA GAGCAGTGGC TCGAGCGAGG GCAGCAGCAT GAACTCTGGC GGTTTAGTGA GACCTGAGCC TTTCTCTGAC
GCGGCGCTTG ATGCCACAGG CACAGATTCT GCCTTCTGAA GAAGCCGCAC CATGCACCTC TCTGATGTGC GAACATGGCT
TCATCTGCAG CTTCGATTCT TGGAATGGAA CCCAAGATAT TTAAAGACAT GATCCGTCAG ACTCATGCAG GAAGCCGAGA
TGTTCCATAG TGCAGTTATG GAATGGTCGA AGAACTAAAA TCTTGGCACC CATTGTCGTG TCCCAGTGAC AGTGTGGACT
ATACAGTTAT ATAACTTATA GTACGTGATT GCTCAGTCGT GAAATTTCAC TAGCCTCGAT ATATTTATCA TGCGCTACGG
TGAAATGATA AGTTTTGTTC TTTGTATCAC TTGCAGTGTG CTTTGTTATT TGTGCAAAGT CGTGTGTGTT GTCTATAGAA
TATTCTTTCG TC

Locus: Os05g0533600

Loading...

Locus: Os05g0533600

Loading...