Os05t0550300-01

Locus

Os05g0550300

Description

Similar to Lipid transfer protein (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.4, OsLtpII.4

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.4, lipid transfer protein 2.4, type 2 non-specific lipid transfer protein 4

Transcript Evidence

AK062463 (DDBJ, Best hit)

Protein Evidence

P93191 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

001-103-D11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0550300-01)

RiceXPro (AK062463)

Others

Oryzabase (13532)

KEGG (Os05t0550300-01)

Transcript

625 bp

>Os05t0550300-01 Similar to Lipid transfer protein (Fragment).
AGGTCATCGTAGCTAGCAATCCTATACAAAGCAAGTAGTAGCAATAACTGGTTCTTGATC
ATTTTTATCTAAGTTCTTAATTTCGATCGCGAAGGGCCATGGCGAAGGTGGCGTTGGCGG
TGGCGGCGATGGCGGTGCTGCTGCTGCTCGCGGCGGCGGCGGCGCCGGGGGCGGAGGCGG
CGTGCGACGCGCTGCAGCTGTCGCCGTGCGCGAGCGCGATCATCGGGAACGCGTCGCCGT
CGGCGTCGTGCTGCAGCCGGATGAAGGAGCAGCAGCCGTGCCTGTGCCAGTACGCGCGCG
ACCCAAACCTGCAGCGCTACGTCAACTCCCCCAACGGCAAGAAGGTCTTGGCCGCCTGCC
ACGTCCCCGTCCCCTCCTGCTAAAACCAAACCATAATACTCCAGTTCTGCGTGCCGTTTA
TACGTGTGTGAGTGCGCCTGTCGCATGGCCCACCTGCCATAGACGCCGTCTATATATGGA
CGTACGTACGTGTCTCGCTTACTTGATTTCGTGTCTGCTTCGACGAGTTCGATCGTGCCG
TGTATTGCGTACGGTTATCCTGCTCTGTATTGGGTATGTATGTATGTATGAATAAATAAA
GCCAGAAATGCAGTTGTACGAGGTT

CDS

285 bp

>Os05t0550300-01 Similar to Lipid transfer protein (Fragment).
ATGGCGAAGGTGGCGTTGGCGGTGGCGGCGATGGCGGTGCTGCTGCTGCTCGCGGCGGCG
GCGGCGCCGGGGGCGGAGGCGGCGTGCGACGCGCTGCAGCTGTCGCCGTGCGCGAGCGCG
ATCATCGGGAACGCGTCGCCGTCGGCGTCGTGCTGCAGCCGGATGAAGGAGCAGCAGCCG
TGCCTGTGCCAGTACGCGCGCGACCCAAACCTGCAGCGCTACGTCAACTCCCCCAACGGC
AAGAAGGTCTTGGCCGCCTGCCACGTCCCCGTCCCCTCCTGCTAA

Protein

95 aa

>Os05t0550300-01 Similar to Lipid transfer protein (Fragment).
MAKVALAVAAMAVLLLLAAAAAPGAEAACDALQLSPCASAIIGNASPSASCCSRMKEQQP
CLCQYARDPNLQRYVNSPNGKKVLAACHVPVPSC*

5'UTR

chr05:27330717..27330814 (+ strand) : 98 bp

CDS

chr05:27330815..27331099 (+ strand) : 285 bp

3'UTR

chr05:27331100..27331341 (+ strand) : 242 bp

FASTA

>Os05t0550300-01 class=Sequence position=chr05:27330717..27331341 (+ strand)
AGGTCATCGT AGCTAGCAAT CCTATACAAA GCAAGTAGTA GCAATAACTG GTTCTTGATC ATTTTTATCT AAGTTCTTAA
TTTCGATCGC GAAGGGCCAT GGCGAAGGTG GCGTTGGCGG TGGCGGCGAT GGCGGTGCTG CTGCTGCTCG CGGCGGCGGC
GGCGCCGGGG GCGGAGGCGG CGTGCGACGC GCTGCAGCTG TCGCCGTGCG CGAGCGCGAT CATCGGGAAC GCGTCGCCGT
CGGCGTCGTG CTGCAGCCGG ATGAAGGAGC AGCAGCCGTG CCTGTGCCAG TACGCGCGCG ACCCAAACCT GCAGCGCTAC
GTCAACTCCC CCAACGGCAA GAAGGTCTTG GCCGCCTGCC ACGTCCCCGT CCCCTCCTGC TAAAACCAAA CCATAATACT
CCAGTTCTGC GTGCCGTTTA TACGTGTGTG AGTGCGCCTG TCGCATGGCC CACCTGCCAT AGACGCCGTC TATATATGGA
CGTACGTACG TGTCTCGCTT ACTTGATTTC GTGTCTGCTT CGACGAGTTC GATCGTGCCG TGTATTGCGT ACGGTTATCC
TGCTCTGTAT TGGGTATGTA TGTATGTATG AATAAATAAA GCCAGAAATG CAGTTGTACG AGGTT

Locus: Os05g0550300

Loading...

Locus: Os05g0550300

Loading...