Os05t0550600-02

Locus

Os05g0550600

Description

Similar to Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.5, OsLtpII.5

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.5, lipid transfer protein 2.5, type 2 non-specific lipid transfer protein 5

Transcript Evidence

AK119689 (DDBJ, Best hit)

AK063729 (DDBJ, Best hit)

Protein Evidence

NP_001152727.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

002-157-B03 (Online Clone Ordering)

001-120-E03 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0550600-02)

RiceXPro (AK119689)

Others

Oryzabase (13533)

KEGG (Os05t0550600-02)

Transcript

579 bp

>Os05t0550600-02 Similar to Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein).
ATTCACAGCAACAGCACATCTCGCAGCTTAATTTCAGCTTACTGATCAGTGATCACTGAG
CTAGCTGAGACAAGTTTTTGAGTATGGCAGCGAAGGCATCTGCAGTGTTCGTCCTGCTGG
TGGTGGTGCTCGCGGTGGCCGCGGCGATGCGGGGAGCGGAGGCGGCGACGTGCACGCCGA
CGCAGCTGACGCCGTGCGCGCCGGCGATCGTGGGGAACTCGCCGCCGACGGCGGCGTGCT
GCGGGAAGCTGAAGGCGCACCCGGCGAGCTGCTTCTGCCAGTACAAGAAGGACCCGAACA
TGAAGAAGTACGTCAACTCGCCCAACGGCAAGAAGGTCTTCGCCACCTGCAAGGTTCCCC
TGCCCAAATGCTAAGCACCTCGTATGGTCACACACGCACTGGTCATCAATACAGTAGCAC
ACCAATGGCATATGCATGGTTTTCAGGCTGCCATTATGCCATATGGGTGTCAGTTTAAGT
ATACTAATAAAATGAGTCACTAGACAGTGTTCTGTTTAAAGTTTCAGAATAAAATCCAGG
CTCAGTACGTGCTCGGTGTGTTATGAGCTTCTGCTCTGC

CDS

291 bp

>Os05t0550600-02 Similar to Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein).
ATGGCAGCGAAGGCATCTGCAGTGTTCGTCCTGCTGGTGGTGGTGCTCGCGGTGGCCGCG
GCGATGCGGGGAGCGGAGGCGGCGACGTGCACGCCGACGCAGCTGACGCCGTGCGCGCCG
GCGATCGTGGGGAACTCGCCGCCGACGGCGGCGTGCTGCGGGAAGCTGAAGGCGCACCCG
GCGAGCTGCTTCTGCCAGTACAAGAAGGACCCGAACATGAAGAAGTACGTCAACTCGCCC
AACGGCAAGAAGGTCTTCGCCACCTGCAAGGTTCCCCTGCCCAAATGCTAA

Protein

97 aa

>Os05t0550600-02 Similar to Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein).
MAAKASAVFVLLVVVLAVAAAMRGAEAATCTPTQLTPCAPAIVGNSPPTAACCGKLKAHP
ASCFCQYKKDPNMKKYVNSPNGKKVFATCKVPLPKC*

5'UTR

chr05:27345715..27345797 (+ strand) : 83 bp

CDS

chr05:27345798..27346088 (+ strand) : 291 bp

3'UTR

chr05:27346089..27346293 (+ strand) : 205 bp

FASTA

>Os05t0550600-02 class=Sequence position=chr05:27345715..27346293 (+ strand)
ATTCACAGCA ACAGCACATC TCGCAGCTTA ATTTCAGCTT ACTGATCAGT GATCACTGAG CTAGCTGAGA CAAGTTTTTG
AGTATGGCAG CGAAGGCATC TGCAGTGTTC GTCCTGCTGG TGGTGGTGCT CGCGGTGGCC GCGGCGATGC GGGGAGCGGA
GGCGGCGACG TGCACGCCGA CGCAGCTGAC GCCGTGCGCG CCGGCGATCG TGGGGAACTC GCCGCCGACG GCGGCGTGCT
GCGGGAAGCT GAAGGCGCAC CCGGCGAGCT GCTTCTGCCA GTACAAGAAG GACCCGAACA TGAAGAAGTA CGTCAACTCG
CCCAACGGCA AGAAGGTCTT CGCCACCTGC AAGGTTCCCC TGCCCAAATG CTAAGCACCT CGTATGGTCA CACACGCACT
GGTCATCAAT ACAGTAGCAC ACCAATGGCA TATGCATGGT TTTCAGGCTG CCATTATGCC ATATGGGTGT CAGTTTAAGT
ATACTAATAA AATGAGTCAC TAGACAGTGT TCTGTTTAAA GTTTCAGAAT AAAATCCAGG CTCAGTACGT GCTCGGTGTG
TTATGAGCTT CTGCTCTGC

Locus: Os05g0550600

Loading...

Locus: Os05g0550600

Loading...