Os05t0551000-01

Locus

Os05g0551000

Description

Iron-binding haemerythrin RING ubiquitin ligase, Iron-binding sensor, Regulation of iron acquisition

RAP-DB Gene Symbol Synonym(s)

OsHRZ2

RAP-DB Gene Name Synonym(s)

HEMERYTHRIN MOTIF-CONTAINING REALLY INTERESTING NEW GENE AND ZINC-FINGER PROTEIN2, Haemerythrin motif-containing RING- and Zn-finger protein2

CGSNL Gene Symbol

HRZ2

CGSNL Gene Name

HAEMERYTHRIN MOTIF-CONTAINING RING- AND ZINC-FINGER PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsRFPH2-24, OsHRZ2

Oryzabase Gene Name Synonym(s)

RING finger protein OsRFPH2-24, RING-H2 protein 24, Haemerythrin motif-containing Really Interesting New Gene (RING)-and Zinc-finger protein 2, Haemerythrin motif-containing RING- and Zinc-finger protein 2

Transcript Evidence

AK068028

BR001013

Protein Evidence

Q6AUD8

Literature

PMID: 24253678

Note

Manual Curation

September 5, 2017

Gene Ontology (GO)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Haemerythrin-like (IPR012312)

Zinc finger, CHY-type (IPR008913)

Zinc finger, CTCHY-type (IPR017921)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type (IPR001841)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytosol (GO:0005829)

Full-length cDNA

J013131L14 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0551000-01)

Others

Oryzabase (11785)

Transcript

2691 bp

>Os05t0551000-01 Iron-binding haemerythrin RING ubiquitin ligase, Iron-binding sensor, Regulation of iron acquisition
TTATATTTCCAGCAGTCAACGATCAAGTGTCCTTTGAGCAGGAGCACGCTGAAGAAGAAC
GGCGGTTTAATAAATTTAGATGTTTAATTGAACAAATCCAAATAACAGGAGCCAGATCAA
CAGCAGTGGATTTTTACTCTGAGCTATGTTCACAAGCTGATCAGATAATGGAGAAAATCG
AGAGGCACTTCAAAAATGAGGAAACAAAGGTACTTCCTCAAGCTAGGATTCATTTTTCAT
CAGAGAAACAAAGGGAACTTTTATATAAGAGTCTCTGTGTCATACCGTTGAAGTTATTGG
AGCGTGTTTTACCGTGGTTTGTATCGAAGCTGAATGATCAGGATGCAGAAGCTTTTCTTC
AGAATATGTTTTTGGCAGCACCTTCCTCTGAAGCTGCATTGGTCACTCTTCTCTCTGGTT
GGGCATGCAAAGGTCGCTCAAAGGGCACCTCTAACTCTGGAAAATTCATATGCTTGACAC
CAAGGGCACTGAGCAGCCCATTGGATGAAAATGGGTTTAAAGACTGCCAGTtatgtccat
gttctttacaatcagatatttgttctaGGCCAGCCAAGAAATGGAATGACACAGAATCTA
GTAACATAAGCAACTGCTCACAAACGGCTGATATAGCATTGACATGTAAAAACAGACCTT
GTCACATTCCTGGGTTAAGGGTAGAAATTAGCAATCTTGCTGTCAATTCGTTTGCTTCTG
CAGAGTCCTTCCGATCGCTGTCTCTCAATTATTCTGCTCCTTCATTGTATTCAAGTCTTT
TTTCATGGGAGACAGATGCAGCCTTTTCTGGCCCAGATAACATTTCAAGGCCAATTGACA
CAATATTCAAATTTCATAAGGCAATTCGCAAAGATTTGGAGTTCTTAGATGTGGAATCTA
GAAAGCTCATAGATGGGGATGAATCTTCCCTTCGCCAATTCATCGGAAGGTTTCGTTTAC
TGTGGGGTCTTTATAGAGCACACAGCAATGCTGAAGATGAAATTGTATTTCCTGCTCTTG
AATCGAAAGAGACACTGCACAATGTCAGCCACTCATATACTCTTGACCACAAGCAGGAAG
AAGAATTATTTAAAGATATATCCACTATTCTTTTTGAGCTTTCACAATTGCATGCTGATT
TGAAGCATCCTCTTGGTGGTGCTGATGCAGTTGGAGCGAACCACATTCATCCATATAATA
GGATCGATTGGTCCAAAAAGAATAATGAACTTTTGACAAAGCTTCAAGGAATGTGCAAGT
CTATCCGGGTTACTCTGTCTAATCATGTCCATAGAGAAGAACTTGAATTGTGGCCACTAT
TTGATAAACATTTTTCTGTAGAGGAGCAGGATAAGATTGTAGGCCGTATAATTGGAAGTA
CAGGAGCTGAGGTTCTGCAGTCAATGTTACCCTGGGTTACATCAGCGCTTAGTCTAGATG
AACAGAACAATATGCTGGACACATGGAGGCAAGTAACTAAGAATACAATGTTTGATGAAT
GGCTAAATGAATGGTGGAAGAGATCACCTACTTCTTCTGGCCCTTCAAGCGATGCCTCCC
ATCCAGAAGAAGATCATTTCCAGGAAAAGTTCGATCAGAGTGAACAGATGTTTAAGCCTG
GTTGGAAGGACATCTTCCGAATGAACCAGAGTGAGCTTGAGGCTGAGATACGAAAGGTTT
CTCGTGATTCTACTCTTGACCCAAGGAGGAAGGCTTATCTAATCCAAAATCTCATGACCA
GCCGCTGGATAGCTGCTCAGCAGAAATCGCCCCAACCTCAGTCAGAAGATCGCAATGGAT
GTACAGTATTACCTGGATGTTGTCCTTCATACCGAGATCCAGAGAATCAGATTTTTGGCT
GTGAGCATTACAAAAGGAAATGCAAACTTGTTGCTGCATGCTGCAATAAACTGTTCACAT
GCAGGTTTTGTCATGATAAAGTTAGTGACCATACAATGGAAAGGAAAGCAACGGTGGAAA
TGATGTGCATGCAATGCCTGAAAGTTCAACCAGTTGGTCCAAATTGCCAGACCCCTTCTT
GCAATGGGCTATCCATGGCAAAGTATTATTGCAGCGTATGCAAGTTTTTTGACGATGAAA
GGAGTGTGTACCATTGCCCCTTTTGCAATTTGTGTCGTCTTGGGCAAGGATTGGGTATTG
ATTTTTTCCATTGCATGAAGTGCAACTGTTGCCTGGGCATGAAATTGATAGAGCATAAAT
GTCGAGAAAAGATGCTAGAGATGAATTGCCCAATCTGCTGCGACTTCCTATTTACATCGA
GTGCAGCAGTTAAAGGTCTACCTTGTGGCCATTTCATGCATTCAGCTTGCTTTCAGGCGT
ACACCTGTAGTCACTACACCTGCCCAATCTGCTCTAAATCCTTGGGAGATATGACAGTAT
ACTTTGGCATGCTTGATGGCTTGCTGGCCGCAGAAGAGCTTCCTGAGGAATACCGGGACC
GGTGCCAGGATATACTTTGTAACGATTGTGAAAGAAAAGGAAGGTCTCGGTTCCATTGGC
TGTATCACAAATGCGGCTTCTGCGGTTCATATAACACTAGAGTTATCAAGATTGATAGAG
CTGATTGTTCAACATCAGATTAACCAGGCGAGATTTTCCCTCTCATATTCGAAATTCCTT
TTGAATATATATATTGTTGTAAATATACATCAACTTAAAGAAATCCATGCG

CDS

2436 bp

>Os05t0551000-01 Iron-binding haemerythrin RING ubiquitin ligase, Iron-binding sensor, Regulation of iron acquisition
ATGGAGAAAATCGAGAGGCACTTCAAAAATGAGGAAACAAAGGTACTTCCTCAAGCTAGG
ATTCATTTTTCATCAGAGAAACAAAGGGAACTTTTATATAAGAGTCTCTGTGTCATACCG
TTGAAGTTATTGGAGCGTGTTTTACCGTGGTTTGTATCGAAGCTGAATGATCAGGATGCA
GAAGCTTTTCTTCAGAATATGTTTTTGGCAGCACCTTCCTCTGAAGCTGCATTGGTCACT
CTTCTCTCTGGTTGGGCATGCAAAGGTCGCTCAAAGGGCACCTCTAACTCTGGAAAATTC
ATATGCTTGACACCAAGGGCACTGAGCAGCCCATTGGATGAAAATGGGTTTAAAGACTGC
CAGTtatgtccatgttctttacaatcagatatttgttctaGGCCAGCCAAGAAATGGAAT
GACACAGAATCTAGTAACATAAGCAACTGCTCACAAACGGCTGATATAGCATTGACATGT
AAAAACAGACCTTGTCACATTCCTGGGTTAAGGGTAGAAATTAGCAATCTTGCTGTCAAT
TCGTTTGCTTCTGCAGAGTCCTTCCGATCGCTGTCTCTCAATTATTCTGCTCCTTCATTG
TATTCAAGTCTTTTTTCATGGGAGACAGATGCAGCCTTTTCTGGCCCAGATAACATTTCA
AGGCCAATTGACACAATATTCAAATTTCATAAGGCAATTCGCAAAGATTTGGAGTTCTTA
GATGTGGAATCTAGAAAGCTCATAGATGGGGATGAATCTTCCCTTCGCCAATTCATCGGA
AGGTTTCGTTTACTGTGGGGTCTTTATAGAGCACACAGCAATGCTGAAGATGAAATTGTA
TTTCCTGCTCTTGAATCGAAAGAGACACTGCACAATGTCAGCCACTCATATACTCTTGAC
CACAAGCAGGAAGAAGAATTATTTAAAGATATATCCACTATTCTTTTTGAGCTTTCACAA
TTGCATGCTGATTTGAAGCATCCTCTTGGTGGTGCTGATGCAGTTGGAGCGAACCACATT
CATCCATATAATAGGATCGATTGGTCCAAAAAGAATAATGAACTTTTGACAAAGCTTCAA
GGAATGTGCAAGTCTATCCGGGTTACTCTGTCTAATCATGTCCATAGAGAAGAACTTGAA
TTGTGGCCACTATTTGATAAACATTTTTCTGTAGAGGAGCAGGATAAGATTGTAGGCCGT
ATAATTGGAAGTACAGGAGCTGAGGTTCTGCAGTCAATGTTACCCTGGGTTACATCAGCG
CTTAGTCTAGATGAACAGAACAATATGCTGGACACATGGAGGCAAGTAACTAAGAATACA
ATGTTTGATGAATGGCTAAATGAATGGTGGAAGAGATCACCTACTTCTTCTGGCCCTTCA
AGCGATGCCTCCCATCCAGAAGAAGATCATTTCCAGGAAAAGTTCGATCAGAGTGAACAG
ATGTTTAAGCCTGGTTGGAAGGACATCTTCCGAATGAACCAGAGTGAGCTTGAGGCTGAG
ATACGAAAGGTTTCTCGTGATTCTACTCTTGACCCAAGGAGGAAGGCTTATCTAATCCAA
AATCTCATGACCAGCCGCTGGATAGCTGCTCAGCAGAAATCGCCCCAACCTCAGTCAGAA
GATCGCAATGGATGTACAGTATTACCTGGATGTTGTCCTTCATACCGAGATCCAGAGAAT
CAGATTTTTGGCTGTGAGCATTACAAAAGGAAATGCAAACTTGTTGCTGCATGCTGCAAT
AAACTGTTCACATGCAGGTTTTGTCATGATAAAGTTAGTGACCATACAATGGAAAGGAAA
GCAACGGTGGAAATGATGTGCATGCAATGCCTGAAAGTTCAACCAGTTGGTCCAAATTGC
CAGACCCCTTCTTGCAATGGGCTATCCATGGCAAAGTATTATTGCAGCGTATGCAAGTTT
TTTGACGATGAAAGGAGTGTGTACCATTGCCCCTTTTGCAATTTGTGTCGTCTTGGGCAA
GGATTGGGTATTGATTTTTTCCATTGCATGAAGTGCAACTGTTGCCTGGGCATGAAATTG
ATAGAGCATAAATGTCGAGAAAAGATGCTAGAGATGAATTGCCCAATCTGCTGCGACTTC
CTATTTACATCGAGTGCAGCAGTTAAAGGTCTACCTTGTGGCCATTTCATGCATTCAGCT
TGCTTTCAGGCGTACACCTGTAGTCACTACACCTGCCCAATCTGCTCTAAATCCTTGGGA
GATATGACAGTATACTTTGGCATGCTTGATGGCTTGCTGGCCGCAGAAGAGCTTCCTGAG
GAATACCGGGACCGGTGCCAGGATATACTTTGTAACGATTGTGAAAGAAAAGGAAGGTCT
CGGTTCCATTGGCTGTATCACAAATGCGGCTTCTGCGGTTCATATAACACTAGAGTTATC
AAGATTGATAGAGCTGATTGTTCAACATCAGATTAA

Protein

812 aa

>Os05t0551000-01 Iron-binding haemerythrin RING ubiquitin ligase, Iron-binding sensor, Regulation of iron acquisition
MEKIERHFKNEETKVLPQARIHFSSEKQRELLYKSLCVIPLKLLERVLPWFVSKLNDQDA
EAFLQNMFLAAPSSEAALVTLLSGWACKGRSKGTSNSGKFICLTPRALSSPLDENGFKDC
QLCPCSLQSDICSRPAKKWNDTESSNISNCSQTADIALTCKNRPCHIPGLRVEISNLAVN
SFASAESFRSLSLNYSAPSLYSSLFSWETDAAFSGPDNISRPIDTIFKFHKAIRKDLEFL
DVESRKLIDGDESSLRQFIGRFRLLWGLYRAHSNAEDEIVFPALESKETLHNVSHSYTLD
HKQEEELFKDISTILFELSQLHADLKHPLGGADAVGANHIHPYNRIDWSKKNNELLTKLQ
GMCKSIRVTLSNHVHREELELWPLFDKHFSVEEQDKIVGRIIGSTGAEVLQSMLPWVTSA
LSLDEQNNMLDTWRQVTKNTMFDEWLNEWWKRSPTSSGPSSDASHPEEDHFQEKFDQSEQ
MFKPGWKDIFRMNQSELEAEIRKVSRDSTLDPRRKAYLIQNLMTSRWIAAQQKSPQPQSE
DRNGCTVLPGCCPSYRDPENQIFGCEHYKRKCKLVAACCNKLFTCRFCHDKVSDHTMERK
ATVEMMCMQCLKVQPVGPNCQTPSCNGLSMAKYYCSVCKFFDDERSVYHCPFCNLCRLGQ
GLGIDFFHCMKCNCCLGMKLIEHKCREKMLEMNCPICCDFLFTSSAAVKGLPCGHFMHSA
CFQAYTCSHYTCPICSKSLGDMTVYFGMLDGLLAAEELPEEYRDRCQDILCNDCERKGRS
RFHWLYHKCGFCGSYNTRVIKIDRADCSTSD*

5'UTR

chr05:27377539..27377705 (+ strand) : 167 bp

CDS

chr05:27377706..27377747 (+ strand) : 42 bp

chr05:27377848..27378016 (+ strand) : 169 bp

chr05:27378124..27379314 (+ strand) : 1191 bp

chr05:27379971..27380142 (+ strand) : 172 bp

chr05:27380258..27380479 (+ strand) : 222 bp

chr05:27381001..27381138 (+ strand) : 138 bp

chr05:27381247..27381481 (+ strand) : 235 bp

chr05:27381574..27381633 (+ strand) : 60 bp

chr05:27381795..27381866 (+ strand) : 72 bp

chr05:27381944..27382078 (+ strand) : 135 bp

3'UTR

chr05:27382079..27382166 (+ strand) : 88 bp

FASTA

>Os05t0551000-01 class=Sequence position=chr05:27377539..27382166 (+ strand)
TTATATTTCC AGCAGTCAAC GATCAAGTGT CCTTTGAGCA GGAGCACGCT GAAGAAGAAC GGCGGTTTAA TAAATTTAGA
TGTTTAATTG AACAAATCCA AATAACAGGA GCCAGATCAA CAGCAGTGGA TTTTTACTCT GAGCTATGTT CACAAGCTGA
TCAGATAATG GAGAAAATCG AGAGGCACTT CAAAAATGAG GAAACAAAGG TTAGTATTTT AGACATAAAC TCTGTAGTTA
AGGAGGAATG TTGTCTACTT GGGTCACGTG ACCAATGTAG TCTAACATGT AATTCATCTA AATATCCAGG TACTTCCTCA
AGCTAGGATT CATTTTTCAT CAGAGAAACA AAGGGAACTT TTATATAAGA GTCTCTGTGT CATACCGTTG AAGTTATTGG
AGCGTGTTTT ACCGTGGTTT GTATCGAAGC TGAATGATCA GGATGCAGAA GCTTTTCTTC AGAATATGTT TTTGGCAGGT
TATTTTCCAA GTTTACTATT TTCTTCTTTA AAACACCAGT TTTTTTTTTC CAAAAAAAAA AAATTCTCAA CATTTTACTG
TTTACTAATA TGTTGAACTG AACAGCACCT TCCTCTGAAG CTGCATTGGT CACTCTTCTC TCTGGTTGGG CATGCAAAGG
TCGCTCAAAG GGCACCTCTA ACTCTGGAAA ATTCATATGC TTGACACCAA GGGCACTGAG CAGCCCATTG GATGAAAATG
GGTTTAAAGA CTGCCAGTta tgtccatgtt ctttacaatc agatatttgt tctaGGCCAG CCAAGAAATG GAATGACACA
GAATCTAGTA ACATAAGCAA CTGCTCACAA ACGGCTGATA TAGCATTGAC ATGTAAAAAC AGACCTTGTC ACATTCCTGG
GTTAAGGGTA GAAATTAGCA ATCTTGCTGT CAATTCGTTT GCTTCTGCAG AGTCCTTCCG ATCGCTGTCT CTCAATTATT
CTGCTCCTTC ATTGTATTCA AGTCTTTTTT CATGGGAGAC AGATGCAGCC TTTTCTGGCC CAGATAACAT TTCAAGGCCA
ATTGACACAA TATTCAAATT TCATAAGGCA ATTCGCAAAG ATTTGGAGTT CTTAGATGTG GAATCTAGAA AGCTCATAGA
TGGGGATGAA TCTTCCCTTC GCCAATTCAT CGGAAGGTTT CGTTTACTGT GGGGTCTTTA TAGAGCACAC AGCAATGCTG
AAGATGAAAT TGTATTTCCT GCTCTTGAAT CGAAAGAGAC ACTGCACAAT GTCAGCCACT CATATACTCT TGACCACAAG
CAGGAAGAAG AATTATTTAA AGATATATCC ACTATTCTTT TTGAGCTTTC ACAATTGCAT GCTGATTTGA AGCATCCTCT
TGGTGGTGCT GATGCAGTTG GAGCGAACCA CATTCATCCA TATAATAGGA TCGATTGGTC CAAAAAGAAT AATGAACTTT
TGACAAAGCT TCAAGGAATG TGCAAGTCTA TCCGGGTTAC TCTGTCTAAT CATGTCCATA GAGAAGAACT TGAATTGTGG
CCACTATTTG ATAAACATTT TTCTGTAGAG GAGCAGGATA AGATTGTAGG CCGTATAATT GGAAGTACAG GAGCTGAGGT
TCTGCAGTCA ATGTTACCCT GGGTTACATC AGCGCTTAGT CTAGATGAAC AGAACAATAT GCTGGACACA TGGAGGCAAG
TAACTAAGAA TACAATGTTT GATGAATGGC TAAATGAATG GTGGAAGAGA TCACCTACTT CTTCTGGCCC TTCAAGCGAT
GCCTCCCATC CAGAAGGTCT GCTCAATTAA TTTCCATCCC ATCTCCCCTC TTCAACCACT TCCACCATAT TTTAGTTTGC
TATGTTATGT AGGCACTCAC TGTTTTCCAT TTCATAAAAT TGTGTCAAAG CTATATCCTT TTCCCCATTG AAGAAACTTC
TATCGAGGCC CACTTGTTAT ATATTGTGTT AGATAAAGGT GTTATCCCTT ACAATGGTTA TCAACAAATA AGATTGGCCT
TCTAATGAGC AACATATAAA CTTCATACAT TGGTTAGTTT CTGTGTTATC TGAATAAAAA TTATCACTAA TTGGACAAAT
GTAGTTGGCC AAAAGGAAAT TCGGGAAATG TTCAAAAGCA AAGAAGCTGT AAAATTATAT CCATGTATTT GTTGATATGT
GATAAGTGAT AACACCATGA CAACGAGGAC TTCCCAATTG ATGACTAATT TCAACTGTCC TAGCTAGCGA TAGTGCAAAT
CTATTATGAT GTAAATTTGT GATAAAAGAG ATTTAGTGAA GTTGGACTTA GCATAAAGGA AGGTAGAATG GTGTTAGAAG
AGAGAAAAGT AGTGGGTCTG GGATGTATAT TTATGATAAA AGATTAAGCA CTACAGTTTT CATGATCAGA TTTTGAATTA
TCTTAACTCT TGTTCTTTGC TTTGGCCTGT AGAAGATCAT TTCCAGGAAA AGTTCGATCA GAGTGAACAG ATGTTTAAGC
CTGGTTGGAA GGACATCTTC CGAATGAACC AGAGTGAGCT TGAGGCTGAG ATACGAAAGG TTTCTCGTGA TTCTACTCTT
GACCCAAGGA GGAAGGCTTA TCTAATCCAA AATCTCATGA CCAGGTTTCT TATATGAAAT TTTCAGAAAA CAATTTTAGG
ATCTTTTCCT ACTGTTCCTC CACTACAATA TAGGAAGTTA TTTTGAATGA CTATTGTTTT GCTAATTATA TTTTTTCAGC
CGCTGGATAG CTGCTCAGCA GAAATCGCCC CAACCTCAGT CAGAAGATCG CAATGGATGT ACAGTATTAC CTGGATGTTG
TCCTTCATAC CGAGATCCAG AGAATCAGAT TTTTGGCTGT GAGCATTACA AAAGGAAATG CAAACTTGTT GCTGCATGCT
GCAATAAACT GTTCACATGC AGGTTTTGTC ATGATAAAGT TAGTGACCAT ACAATGGAAA GGTAAACTCA GTGCAACCAT
GTTGTCTATT TTTTTGAGAT TTACTGCCAA TGATACTTCT GTATTGGTCG CAGTAGTAAT GTGTTCAATA TTCATTTTTA
AACACCAAAC AACAGACATC AATAAGCATG CAGTGGTTAA AGATTTAACT ACAGTTAGAG AACCTTGTGA TAAATTTATA
TCTGTGCAAA ACAGTGAGGC AGAATGATTA TTTTAGGCAT GACTTGTGGC CTTTGTATTG TCCCTTTCGT TCTTCTCTTC
ATCTGTTGTT TTCCTCCCAA GTAAATGTTT GGTTGAAATG ATGCGATGGC CCAAAAAGTT GTCCAATATG AACTTTTCCG
TCTTTAGTTT TTTAATCGCT GTATTTGCAT GATAGGTGTA TACAGAGTTT TAAGAACATG TGAGAGAGGA TAGGAGGCAG
AAACTCTCCT GTTTTCTATC ATATTATGTG TTGGTTGTTA TAGCTTTGTT ATAATATAAA ATGCTAAATG ATATTGCTAA
GTCTGGGGAG CTGATATGTC AGGAAAGCAA CGGTGGAAAT GATGTGCATG CAATGCCTGA AAGTTCAACC AGTTGGTCCA
AATTGCCAGA CCCCTTCTTG CAATGGGCTA TCCATGGCAA AGTATTATTG CAGCGTATGC AAGTTTTTTG ACGATGAAAG
GTAAAAAAAA AAAAAGGACG TGGTTGCTAG TTTTGCTAAC TCGGGAGATT GATGGGGTCC AACTTTGCAA TGTTTTGGTG
ACCACGCTAA TAGTGAATCT TTTTTCAGGA GTGTGTACCA TTGCCCCTTT TGCAATTTGT GTCGTCTTGG GCAAGGATTG
GGTATTGATT TTTTCCATTG CATGAAGTGC AACTGTTGCC TGGGCATGAA ATTGATAGAG CATAAATGTC GAGAAAAGAT
GCTAGAGATG AATTGCCCAA TCTGCTGCGA CTTCCTATTT ACATCGAGTG CAGCAGTTAA AGGTCTACCT TGTGGCCATT
TCATGCATTC AGCTTGCTTT CAGGTACAAT AATCTAGTCG CATTCTGATG CATGGTTTCT TGAGCGATAT CTCTTACTGT
GAGTAGTGCT GTTCTGACAA GTTTGTAAAT TTCAGGCGTA CACCTGTAGT CACTACACCT GCCCAATCTG CTCTAAATCC
TTGGGAGATA TGACAGTAAG CTACACCACT TAAATAACAT TTTTTTTCAT TCACCATAGA TTATATTTTC TCCAACTCCA
TATTTTTACC ATACACAGAA CAGCTTGTAA AAAATTCCGT TCTTCTGATT CAGTAGTGCA GTTAATGTAT GTTCTTTAAA
TCGCGTTTCT CTGCAGGTAT ACTTTGGCAT GCTTGATGGC TTGCTGGCCG CAGAAGAGCT TCCTGAGGAA TACCGGGACC
GGTGCCAGGT AAATTATTCT CCTATTCCTA GTTAAAAAAA TTTCAGTGGC TGGGGTATAC CGTTTGATAT GATTGATTGT
TCCAGGATAT ACTTTGTAAC GATTGTGAAA GAAAAGGAAG GTCTCGGTTC CATTGGCTGT ATCACAAATG CGGCTTCTGC
GGTTCATATA ACACTAGAGT TATCAAGATT GATAGAGCTG ATTGTTCAAC ATCAGATTAA CCAGGCGAGA TTTTCCCTCT
CATATTCGAA ATTCCTTTTG AATATATATA TTGTTGTAAA TATACATCAA CTTAAAGAAA TCCATGCG

Locus: Os05g0551000

Loading...

Locus: Os05g0551000

Loading...