Os05t0553400-01

Locus

Os05g0553400

Description

R2R3-MYB transcription factor, Tolerance to high temperature, Modulation of amino acid metabolism, Anthocyanin synthesis, Hormonal signaling

RAP-DB Gene Symbol Synonym(s)

OsMYB55, OsPL

RAP-DB Gene Name Synonym(s)

R2R3-MYB Transcription Factor 55, purple leaf

CGSNL Gene Symbol

PL

CGSNL Gene Name

PURPLE LEAF

Oryzabase Gene Symbol Synonym(s)

OsMYB55, OsMYB-2, MYB55, MYB-2, OsPL

Oryzabase Gene Name Synonym(s)

R2R3-MYB Transcription Factor 55, R2R3-MYB Transcription Factor OsMYB55, purple leaf

Transcript Evidence

AK108452

Protein Evidence

A0A0P0WQQ7

Literature

PMID: 30858135

PMID: 23251677

Note

Manual Curation

July 16, 2020

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Homeobox-like domain superfamily (IPR009057)

SANT/Myb domain (IPR001005)

Myb domain (IPR017930)

Full-length cDNA

002-143-C10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0553400-01)

RiceXPro (AK108452)

Others

Oryzabase (11680)

KEGG (Os05t0553400-01)

Transcript

1262 bp

>Os05t0553400-01 R2R3-MYB transcription factor, Tolerance to high temperature, Modulation of amino acid metabolism, Anthocyanin synthesis, Hormonal signaling
ATCGGTCGGTCTCGGTCGCTGCCGTCCCTGTGCTTGGAGTAGACACGAGCCGGTGACGCG
CATATCGTCTTCTGCTCGAGATCGATCGATCGATCGCTTGGTTGGTTGCTGCGACTGCGA
GGGAGGCCGCGGGTGGTGAGGAGGATTGTGCAAAAAAAATGGGGCGCGCGCCGTGCTGCG
ACAAGGCGAGCGtgaagcgggggccgtggtcgccggaggaggacgagcagctgcggagct
acgtccagagccacggcatcggcggcaactggatcgcgctcccgcagaaagcagggctca
accgctgcggcaagagctgcaggctccggtggctcaactacctgaggccggacatcaagc
acggcggctacaccgagcaggaggaccacatcatctgctcgctctacaactcgattggaa
gcagGTGGTCCATCATCGCGTCGAAGCTCCCCGGCCGGACTGACAACGACGTCAAGAACT
ACTGGAACACCAAGCTCAAGAAGAAAGCCATGGGCGCCGTGCAGCCGCGCGCCGCCGCCT
CGGCGCCGAGCCAATGCACGTCGTCAGCGATGGCGCCGGCGCTCTCGCCGGCCTCCTCGT
CCGTCACCAGCTCGAGCGGCGACGCCTGCTTCGCCGCCGCCGCCACCACCACCACCACCA
TGTACCCGCCACCGACGACGCCGCCGCAGCAGCAGTTCATCCGCTTCGACGCACCACCCG
CGGCGGCGGCGGCGGCATCCCCGACCGACCTCGCGCCCGTGCCACCACCGGCCACCGTCA
CGGCGGACGGCGACGGCGGCTGGGCGTCCGACGCCTTGTCCCTCGACGACGTGTTCCTCG
GCGAGCTCACGGCCGGCGAGCCGCTGTTCCCTTACGCCGAGCTGTTCAGCGGCTTCGCCG
GCGCGGCGCCGGACAGCAAGGCCACCTTGGAGCTCTCGGCGTGCTACTTCCCGAACATGG
CGGAGATGTGGGCGGCCTCCGACCACGCCTACGCCAAGCCACAGGGTCTCTGCAACACCC
TGACATAGGAGGACACGCTAAAACCTCCATTGAATTCTTGCGTAGCTGCGAACGCAACGG
CGATCGATCGATGCGTCGCCACTTGCTACTAGCATAATTCTTGCTCTCTTTTTTTTTTCA
ATTTTTTTCTCTTCTTCGAGTGGCCCATTCTCTAGCTGGCGTTTTCTCGTGTATTATGAG
TGATCGATTATTACATGTAAATTAATCCATAGATGTATCTGCACTGATCCAAATTCTCCA
GC

CDS

870 bp

>Os05t0553400-01 R2R3-MYB transcription factor, Tolerance to high temperature, Modulation of amino acid metabolism, Anthocyanin synthesis, Hormonal signaling
ATGGGGCGCGCGCCGTGCTGCGACAAGGCGAGCGtgaagcgggggccgtggtcgccggag
gaggacgagcagctgcggagctacgtccagagccacggcatcggcggcaactggatcgcg
ctcccgcagaaagcagggctcaaccgctgcggcaagagctgcaggctccggtggctcaac
tacctgaggccggacatcaagcacggcggctacaccgagcaggaggaccacatcatctgc
tcgctctacaactcgattggaagcagGTGGTCCATCATCGCGTCGAAGCTCCCCGGCCGG
ACTGACAACGACGTCAAGAACTACTGGAACACCAAGCTCAAGAAGAAAGCCATGGGCGCC
GTGCAGCCGCGCGCCGCCGCCTCGGCGCCGAGCCAATGCACGTCGTCAGCGATGGCGCCG
GCGCTCTCGCCGGCCTCCTCGTCCGTCACCAGCTCGAGCGGCGACGCCTGCTTCGCCGCC
GCCGCCACCACCACCACCACCATGTACCCGCCACCGACGACGCCGCCGCAGCAGCAGTTC
ATCCGCTTCGACGCACCACCCGCGGCGGCGGCGGCGGCATCCCCGACCGACCTCGCGCCC
GTGCCACCACCGGCCACCGTCACGGCGGACGGCGACGGCGGCTGGGCGTCCGACGCCTTG
TCCCTCGACGACGTGTTCCTCGGCGAGCTCACGGCCGGCGAGCCGCTGTTCCCTTACGCC
GAGCTGTTCAGCGGCTTCGCCGGCGCGGCGCCGGACAGCAAGGCCACCTTGGAGCTCTCG
GCGTGCTACTTCCCGAACATGGCGGAGATGTGGGCGGCCTCCGACCACGCCTACGCCAAG
CCACAGGGTCTCTGCAACACCCTGACATAG

Protein

290 aa

>Os05t0553400-01 R2R3-MYB transcription factor, Tolerance to high temperature, Modulation of amino acid metabolism, Anthocyanin synthesis, Hormonal signaling
MGRAPCCDKASVKRGPWSPEEDEQLRSYVQSHGIGGNWIALPQKAGLNRCGKSCRLRWLN
YLRPDIKHGGYTEQEDHIICSLYNSIGSRWSIIASKLPGRTDNDVKNYWNTKLKKKAMGA
VQPRAAASAPSQCTSSAMAPALSPASSSVTSSSGDACFAAAATTTTTMYPPPTTPPQQQF
IRFDAPPAAAAAASPTDLAPVPPPATVTADGDGGWASDALSLDDVFLGELTAGEPLFPYA
ELFSGFAGAAPDSKATLELSACYFPNMAEMWAASDHAYAKPQGLCNTLT*

5'UTR

chr05:27526085..27526242 (- strand) : 158 bp

CDS

chr05:27525949..27526084 (- strand) : 136 bp

chr05:27525716..27525845 (- strand) : 130 bp

chr05:27525020..27525623 (- strand) : 604 bp

3'UTR

chr05:27524786..27525019 (- strand) : 234 bp

FASTA

>Os05t0553400-01 class=Sequence position=chr05:27524786..27526242 (- strand)
ATCGGTCGGT CTCGGTCGCT GCCGTCCCTG TGCTTGGAGT AGACACGAGC CGGTGACGCG CATATCGTCT TCTGCTCGAG
ATCGATCGAT CGATCGCTTG GTTGGTTGCT GCGACTGCGA GGGAGGCCGC GGGTGGTGAG GAGGATTGTG CAAAAAAAAT
GGGGCGCGCG CCGTGCTGCG ACAAGGCGAG CGtgaagcgg gggccgtggt cgccggagga ggacgagcag ctgcggagct
acgtccagag ccacggcatc ggcggcaact ggatcgcgct cccgcagaaa gcaggtcggt attagtgcac tgctcgtcgt
cgtcgatgct agccggtgat gaaacgccat gtttgtatgt gaattctgat gtctgcgtgt tctcttgtgt gattcagggc
tcaaccgctg cggcaagagc tgcaggctcc ggtggctcaa ctacctgagg ccggacatca agcacggcgg ctacaccgag
caggaggacc acatcatctg ctcgctctac aactcgattg gaagcaggtG ATGATTTAAG CCGGAGATGA ATATTTCTTT
TTTCTTTCAC TGATCCTGTT CTGAGTTCTT GAACTGACTC TGTTTGCGTG CGTTGCCAGG TGGTCCATCA TCGCGTCGAA
GCTCCCCGGC CGGACTGACA ACGACGTCAA GAACTACTGG AACACCAAGC TCAAGAAGAA AGCCATGGGC GCCGTGCAGC
CGCGCGCCGC CGCCTCGGCG CCGAGCCAAT GCACGTCGTC AGCGATGGCG CCGGCGCTCT CGCCGGCCTC CTCGTCCGTC
ACCAGCTCGA GCGGCGACGC CTGCTTCGCC GCCGCCGCCA CCACCACCAC CACCATGTAC CCGCCACCGA CGACGCCGCC
GCAGCAGCAG TTCATCCGCT TCGACGCACC ACCCGCGGCG GCGGCGGCGG CATCCCCGAC CGACCTCGCG CCCGTGCCAC
CACCGGCCAC CGTCACGGCG GACGGCGACG GCGGCTGGGC GTCCGACGCC TTGTCCCTCG ACGACGTGTT CCTCGGCGAG
CTCACGGCCG GCGAGCCGCT GTTCCCTTAC GCCGAGCTGT TCAGCGGCTT CGCCGGCGCG GCGCCGGACA GCAAGGCCAC
CTTGGAGCTC TCGGCGTGCT ACTTCCCGAA CATGGCGGAG ATGTGGGCGG CCTCCGACCA CGCCTACGCC AAGCCACAGG
GTCTCTGCAA CACCCTGACA TAGGAGGACA CGCTAAAACC TCCATTGAAT TCTTGCGTAG CTGCGAACGC AACGGCGATC
GATCGATGCG TCGCCACTTG CTACTAGCAT AATTCTTGCT CTCTTTTTTT TTTCAATTTT TTTCTCTTCT TCGAGTGGCC
CATTCTCTAG CTGGCGTTTT CTCGTGTATT ATGAGTGATC GATTATTACA TGTAAATTAA TCCATAGATG TATCTGCACT
GATCCAAATT CTCCAGC

Locus: Os05g0553400

Loading...

Locus: Os05g0553400

Loading...