Os05t0554000-02

Locus

Os05g0554000

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MATE2

CGSNL Gene Name

MULTIDRUG AND TOXIC COMPOUND EXTRUSION PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsMATE2

Oryzabase Gene Name Synonym(s)

Multidrug and Toxic compound Extrusion protein 2

Transcript Evidence

AK105402 (DDBJ, Best hit)

Protein Evidence

B6U6E4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: drug transmembrane transport (GO:0006855)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: membrane (GO:0016020)

Molecular Function: drug transmembrane transporter activity (GO:0015238)

Molecular Function: antiporter activity (GO:0015297)

Functional domain (InterPro)

Multi antimicrobial extrusion protein (IPR002528)

Full-length cDNA

001-123-D07 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0554000-02)

RiceXPro (AK105402)

Others

Oryzabase (15521)

KEGG (Os05t0554000-02)

Transcript

2889 bp

>Os05t0554000-02 Similar to predicted protein.
AGACACCAAAGCCGTCTCTGAGAAGAAGAGAGGGAGAGAGAGAGAGAGAGAGAGAGCTCG
GTCGGTGGAGGCGACGACGACGACGCGCGCACTGCGGCCGCCATGGAGGAGAGAATACCT
CTGCTCTCGAAACGATTCCCGGCGGACGGCACCGCCGGAGTGGGAGGAGGGAGGGAGGAG
GAGGGCGGAGATAGGTGGTGGAGCGGGCTGGCGCGGGAGGCAGGAAAGGTGGGGTCCATG
GCGCTGCCCATGGCCGCGATGAGCGTGGCGCAGAACGCCGTGCAGGTGGCGTCCAACATG
ATGGTGGGGCACCTCCCCGGCGTCCTCCCGCTCTCCGCCTCCGCCATCGCCACCTCCCTC
GCCAGCGTCTCCGGCTTCAGCCTCCTCGTTGGAATGGCAAGTGGATTAGAAACTCTCTGC
GGTCAAGCTTATGGGGCAAAACAGTATGACAAGTTAGGAGTGCAAACCTACAGAGCAATA
GTCACACTAACAGTAGTCACAATTCCCATCTCACTTCTATGGGTATTCATAGGCAAACTC
TTGACCCTAATAGGTCAGGACCCCGTGATCTCACATGAAGCTGGAAGATACATAGTGTGG
TTGATTCCAGGACTCTTCGCATACGCGGTCTGCCAGCCTCTCACAAAATTTCTGCAGTCT
CAGAGTCTAATATTTCCCATGCTCTGGTCCTCCATTGCAACTCTGCTCCTGCACATCCCT
CTGTCTTGGCTGTTGGTGTTCAAGACCAGCATGGGATTTACTGGAGCTGCTTTAGCAATT
AGCATATCTTACTGGTTGAATACATTCATGCTCGCTGCATACATCAGATTCTCATGTTCT
TGTAAGGTGACTCGCTCGCCTCCTACAATCGAGGCATTCAGAGGAGTCGGTTTGTTTCTG
CGAATAGCACTACCATCTGCACTAATGTTATGTTTTGAATGGTGGTCATTTGAGATCCTT
GTTCTCCTGTCAGGACTTCTACCCAACCCAGAGCTTGAAAGTTCAGTTCTTTCCATATGG
TAAGAAAATAAGAGTCCTCAATGTCGCACTTAACAATATATTCTCTTATAGCTGCACCTT
TTGTTATTTTATAAGCACTCCATTTATGCAGCTTGACGACTACCTCTTTGATGTATACTA
TACCATATGGTCTTGGAGGCGCTGCAAGCACTCGAGTAGCAAATGAGTTAGGCGCTGGGA
ATCCTGAAGGAGCTCGATCGGCTGTTCACCTTGTAATGTCTATTGCTGGGACAGAGGCAG
TTCTTGTTACTGGGATGCTGTTTGCAGCACAGCGCATCTTGGGCTATGCTTACAGCAGTG
ATGAGGAGGTTGTCACATATTTCACCTCAATGGTTCCTTTTGTGTGCATCTCAGTTGCTG
CTGATAGCCTACAAGGAGTTTTATCAGGTTACATTTCCTAACATTTGATTTATCTGTTAA
TTATTCATTCCCTTCAAAAGAATGGAAAAAATGGAGTATTCAGCTATGCCTGAAGTTTTC
GAAAATTTGATCTAACTGGCCTTGCCTCTCTCTTATTTCATTTTTTTTATATAACTGGTT
CTTATAGTTTTGGGGCCATTACATTTACACCATTCAGTATCTTTAGCCTGTTAGCCCAAC
GGTATCTTTTACCCCTTAGTTTGATTGCTTAATTCAATGTGTGCGCTGTTGTCAAATCTC
TACCAAGACCTCAGGTAGCAAGTTAATTTCAGTCACTCCGGTATCGTAAAGACATACCAG
GTAACTTGCCGCTTCTTGTTTTTCCTTTGTTCAATGAAACTAATGCTATTTTGTGTTGTG
GAGGCCGACATTGTTACTCGGGGAGTTACCTGTTTGTTCCTTCAAACATGTGCTCTTACG
TGAACATGGATATGGTGGTGTTTACAATCAACACGCATCTATCAGCGATGTCGTCTTAAG
TGTGGACTCCACTTCACTAAGTATGCAATTACACCTTTCCCCTGGCTAGTGGTAGACTGG
TAGTGTGGCACTGGTGTTTGCTTCACAGGTCTATTTCATTGTTTGTGCTTCTGAGCAGTT
GTGGACATGCCAAAAACAATGAACTGAACTTGCGAAAACACACATCTCATTCAGCTCCAG
CACGGAAACATACTATTGTTTCTCCTCTCTAGAAGATTATATCAAGATAGATGCACCACA
CGTCATTGCTTAACACTGACAGATATTACTTGTTATCAGGTATTGCTCGGGGTTGCGGAT
GGCAGCACCTGGGAGCCTATGTAAACCTCGGTTCATTCTACCTGGTTGGCATTCCGGTAG
CCCTACTTCTTGGCTTTGGTTTCAAGATGGAAGGCAAAGGGCTTTGGCTGGGCATCGCCT
GTGGTTCCGTATTACAATTCTTGCTTCTCGCCGTCATTGCATTCTTCAGCAACTGGCAAA
AGATGGTTTGTTTCTTTATCTGAAACTCCAAGCCTTCTCCCCAACATCATCAAATCTTGA
TCACTCGAAAACTGAATCATGTTTCTCCCGCCTACTGACCTGATGCTGCTTCTGCAGGCC
GAGAAAGCGAGGGAGAGAATTTTCGGCGAGACACCGTCAGAGAAGCAACATTTGGTGCTT
GATGCAACGAATTCGGTCTGATTCTGCATCCTGATCCGTTGACGCGAACTGAAGCGGATG
ATCGGATCATGTGGAGGAGACTGGCTCCTCTGGATGTGTAGGGAATCTGCTGAAGAAGTA
AAGCAGTGTGCATAGTTGTACTGTTGCATTTGTTGGATCCGGGAGAATGTATCAAGAACT
CTATGTGAAATGTATGATGGCGATATGTATGTACGAGATCGAGGTTCCGAATACTTCCAG
CCTATAGAAGTATAGATAAATTTTCCACTCTTCGTGGACAGAAAGAATAAAAGGCTAATC
TTCTCTCGG

CDS

921 bp

>Os05t0554000-02 Similar to predicted protein.
ATGGAGGAGAGAATACCTCTGCTCTCGAAACGATTCCCGGCGGACGGCACCGCCGGAGTG
GGAGGAGGGAGGGAGGAGGAGGGCGGAGATAGGTGGTGGAGCGGGCTGGCGCGGGAGGCA
GGAAAGGTGGGGTCCATGGCGCTGCCCATGGCCGCGATGAGCGTGGCGCAGAACGCCGTG
CAGGTGGCGTCCAACATGATGGTGGGGCACCTCCCCGGCGTCCTCCCGCTCTCCGCCTCC
GCCATCGCCACCTCCCTCGCCAGCGTCTCCGGCTTCAGCCTCCTCGTTGGAATGGCAAGT
GGATTAGAAACTCTCTGCGGTCAAGCTTATGGGGCAAAACAGTATGACAAGTTAGGAGTG
CAAACCTACAGAGCAATAGTCACACTAACAGTAGTCACAATTCCCATCTCACTTCTATGG
GTATTCATAGGCAAACTCTTGACCCTAATAGGTCAGGACCCCGTGATCTCACATGAAGCT
GGAAGATACATAGTGTGGTTGATTCCAGGACTCTTCGCATACGCGGTCTGCCAGCCTCTC
ACAAAATTTCTGCAGTCTCAGAGTCTAATATTTCCCATGCTCTGGTCCTCCATTGCAACT
CTGCTCCTGCACATCCCTCTGTCTTGGCTGTTGGTGTTCAAGACCAGCATGGGATTTACT
GGAGCTGCTTTAGCAATTAGCATATCTTACTGGTTGAATACATTCATGCTCGCTGCATAC
ATCAGATTCTCATGTTCTTGTAAGGTGACTCGCTCGCCTCCTACAATCGAGGCATTCAGA
GGAGTCGGTTTGTTTCTGCGAATAGCACTACCATCTGCACTAATGTTATGTTTTGAATGG
TGGTCATTTGAGATCCTTGTTCTCCTGTCAGGACTTCTACCCAACCCAGAGCTTGAAAGT
TCAGTTCTTTCCATATGGTAA

Protein

307 aa

>Os05t0554000-02 Similar to predicted protein.
MEERIPLLSKRFPADGTAGVGGGREEEGGDRWWSGLAREAGKVGSMALPMAAMSVAQNAV
QVASNMMVGHLPGVLPLSASAIATSLASVSGFSLLVGMASGLETLCGQAYGAKQYDKLGV
QTYRAIVTLTVVTIPISLLWVFIGKLLTLIGQDPVISHEAGRYIVWLIPGLFAYAVCQPL
TKFLQSQSLIFPMLWSSIATLLLHIPLSWLLVFKTSMGFTGAALAISISYWLNTFMLAAY
IRFSCSCKVTRSPPTIEAFRGVGLFLRIALPSALMLCFEWWSFEILVLLSGLLPNPELES
SVLSIW*

5'UTR

chr05:27542128..27542229 (+ strand) : 102 bp

CDS

chr05:27542230..27542514 (+ strand) : 285 bp

chr05:27543221..27543765 (+ strand) : 545 bp

chr05:27543876..27543966 (+ strand) : 91 bp

3'UTR

chr05:27543967..27544111 (+ strand) : 145 bp

chr05:27544202..27545922 (+ strand) : 1721 bp

FASTA

>Os05t0554000-02 class=Sequence position=chr05:27542128..27545922 (+ strand)
AGACACCAAA GCCGTCTCTG AGAAGAAGAG AGGGAGAGAG AGAGAGAGAG AGAGAGCTCG GTCGGTGGAG GCGACGACGA
CGACGCGCGC ACTGCGGCCG CCATGGAGGA GAGAATACCT CTGCTCTCGA AACGATTCCC GGCGGACGGC ACCGCCGGAG
TGGGAGGAGG GAGGGAGGAG GAGGGCGGAG ATAGGTGGTG GAGCGGGCTG GCGCGGGAGG CAGGAAAGGT GGGGTCCATG
GCGCTGCCCA TGGCCGCGAT GAGCGTGGCG CAGAACGCCG TGCAGGTGGC GTCCAACATG ATGGTGGGGC ACCTCCCCGG
CGTCCTCCCG CTCTCCGCCT CCGCCATCGC CACCTCCCTC GCCAGCGTCT CCGGCTTCAG CCTCCTCGTA CGTCGTCATC
GCATATCCTG ATTTCCCCAC TCGTTCACGC GTCCTCGATT TGCTTATATC CATATTTGTT GCCTGCGTGA TTTGGTCTCA
TTGGATTAAC TGTTTAGCAC TTTAGCCAGA GAGGCACGTT TCACGGTTTC AGATATTGTT CAATGTGGCG TTCAAATTTA
GCAGTAGGAG GACAGGCAAA AAGTTTAGCC GTACAAGCGG CTGGTTAGTT TGGAAGGGGG ATTTTGATTG GAACAGTGCC
TAAAATTTTT GCTGGAATAC TGTTTGAACA TTTGGCGTGT TCCAAACATT CTGAAATAAA TCATGGATAT AGCATAGTAA
GTAGCAGATT TTTTTTTTTT GGGTATACAA GTAGCAGTTT GCAAACCTAC AAAATTTAAA ATCAACGTTC TCCTAAATAT
AGAGATAAAT AACAAGTTAC ACTACTAGTC TACTACTCCA CGCTGAATGC TTTTCTAGGA TGAATTTTAA ATTGCCTGCA
CAGATGGTGA GCTAGTCAAT TGTCACGATT TCAACTAGCT TTCAGAATCT GCGAAGTGTG TACAGCCTAG AGGACTACTT
CGATACTCTG GCGAAATATT CTGTAGGATT TTTTTTTTTT ACTTTTCTCT TCAGTTGTAC ACGGATTGCC TTTTTAGTTT
GTGATCTTAA TTTTGAAACC ACCCATAATT TGAATTTTGA ACTTGTAAAA CAGGTTGGAA TGGCAAGTGG ATTAGAAACT
CTCTGCGGTC AAGCTTATGG GGCAAAACAG TATGACAAGT TAGGAGTGCA AACCTACAGA GCAATAGTCA CACTAACAGT
AGTCACAATT CCCATCTCAC TTCTATGGGT ATTCATAGGC AAACTCTTGA CCCTAATAGG TCAGGACCCC GTGATCTCAC
ATGAAGCTGG AAGATACATA GTGTGGTTGA TTCCAGGACT CTTCGCATAC GCGGTCTGCC AGCCTCTCAC AAAATTTCTG
CAGTCTCAGA GTCTAATATT TCCCATGCTC TGGTCCTCCA TTGCAACTCT GCTCCTGCAC ATCCCTCTGT CTTGGCTGTT
GGTGTTCAAG ACCAGCATGG GATTTACTGG AGCTGCTTTA GCAATTAGCA TATCTTACTG GTTGAATACA TTCATGCTCG
CTGCATACAT CAGATTCTCA TGTTCTTGTA AGGTGACTCG CTCGCCTCCT ACAATCGAGG CATTCAGAGG AGTCGGTTTG
TTTCTGCGAA TAGCACTACC ATCTGCACTA ATGTTATGGT AATTACAGTA GCTTCAGAAT CTCCTTGTTT TATATGTAAG
TATTTCTTAT TTCCTGTTAA AAAATTCCCA CTTATTGGAT TAATGGATTT TCTTCTATTA TTTTGTAGTT TTGAATGGTG
GTCATTTGAG ATCCTTGTTC TCCTGTCAGG ACTTCTACCC AACCCAGAGC TTGAAAGTTC AGTTCTTTCC ATATGGTAAG
AAAATAAGAG TCCTCAATGT CGCACTTAAC AATATATTCT CTTATAGCTG CACCTTTTGT TATTTTATAA GCACTCCATT
TATGCAGCTT GACGACTACC TCTTTGATGT ATACTATACC ATATGGTCTT GGAGGCGCTG CAAGGTAGAA GCCAAACCAC
TACTGTGAAT GATTATTTTT TCTCAGAGAA TAATCATGTG TTAACAGCCT TGTGAATTTT GTTTTAATGA ACAGCACTCG
AGTAGCAAAT GAGTTAGGCG CTGGGAATCC TGAAGGAGCT CGATCGGCTG TTCACCTTGT AATGTCTATT GCTGGGACAG
AGGCAGTTCT TGTTACTGGG ATGCTGTTTG CAGCACAGCG CATCTTGGGC TATGCTTACA GCAGTGATGA GGAGGTTGTC
ACATATTTCA CCTCAATGGT TCCTTTTGTG TGCATCTCAG TTGCTGCTGA TAGCCTACAA GGAGTTTTAT CAGGTTACAT
TTCCTAACAT TTGATTTATC TGTTAATTAT TCATTCCCTT CAAAAGAATG GAAAAAATGG AGTATTCAGC TATGCCTGAA
GTTTTCGAAA ATTTGATCTA ACTGGCCTTG CCTCTCTCTT ATTTCATTTT TTTTATATAA CTGGTTCTTA TAGTTTTGGG
GCCATTACAT TTACACCATT CAGTATCTTT AGCCTGTTAG CCCAACGGTA TCTTTTACCC CTTAGTTTGA TTGCTTAATT
CAATGTGTGC GCTGTTGTCA AATCTCTACC AAGACCTCAG GTAGCAAGTT AATTTCAGTC ACTCCGGTAT CGTAAAGACA
TACCAGGTAA CTTGCCGCTT CTTGTTTTTC CTTTGTTCAA TGAAACTAAT GCTATTTTGT GTTGTGGAGG CCGACATTGT
TACTCGGGGA GTTACCTGTT TGTTCCTTCA AACATGTGCT CTTACGTGAA CATGGATATG GTGGTGTTTA CAATCAACAC
GCATCTATCA GCGATGTCGT CTTAAGTGTG GACTCCACTT CACTAAGTAT GCAATTACAC CTTTCCCCTG GCTAGTGGTA
GACTGGTAGT GTGGCACTGG TGTTTGCTTC ACAGGTCTAT TTCATTGTTT GTGCTTCTGA GCAGTTGTGG ACATGCCAAA
AACAATGAAC TGAACTTGCG AAAACACACA TCTCATTCAG CTCCAGCACG GAAACATACT ATTGTTTCTC CTCTCTAGAA
GATTATATCA AGATAGATGC ACCACACGTC ATTGCTTAAC ACTGACAGAT ATTACTTGTT ATCAGGTATT GCTCGGGGTT
GCGGATGGCA GCACCTGGGA GCCTATGTAA ACCTCGGTTC ATTCTACCTG GTTGGCATTC CGGTAGCCCT ACTTCTTGGC
TTTGGTTTCA AGATGGAAGG CAAAGGGCTT TGGCTGGGCA TCGCCTGTGG TTCCGTATTA CAATTCTTGC TTCTCGCCGT
CATTGCATTC TTCAGCAACT GGCAAAAGAT GGTTTGTTTC TTTATCTGAA ACTCCAAGCC TTCTCCCCAA CATCATCAAA
TCTTGATCAC TCGAAAACTG AATCATGTTT CTCCCGCCTA CTGACCTGAT GCTGCTTCTG CAGGCCGAGA AAGCGAGGGA
GAGAATTTTC GGCGAGACAC CGTCAGAGAA GCAACATTTG GTGCTTGATG CAACGAATTC GGTCTGATTC TGCATCCTGA
TCCGTTGACG CGAACTGAAG CGGATGATCG GATCATGTGG AGGAGACTGG CTCCTCTGGA TGTGTAGGGA ATCTGCTGAA
GAAGTAAAGC AGTGTGCATA GTTGTACTGT TGCATTTGTT GGATCCGGGA GAATGTATCA AGAACTCTAT GTGAAATGTA
TGATGGCGAT ATGTATGTAC GAGATCGAGG TTCCGAATAC TTCCAGCCTA TAGAAGTATA GATAAATTTT CCACTCTTCG
TGGACAGAAA GAATAAAAGG CTAATCTTCT CTCGG

Locus: Os05g0554000

Loading...

Locus: Os05g0554000

Loading...