Os05t0554000-03

Locus

Os05g0554000

Description

Multidrug and toxic compound extrusion (MATE) protein family transporter, Arsenic stress response, Regulation of plant growth and development, Disease resistance

RAP-DB Gene Symbol Synonym(s)

OsMATE2

RAP-DB Gene Name Synonym(s)

Multidrug and Toxic compound Extrusion protein 2

CGSNL Gene Symbol

MATE2

CGSNL Gene Name

MULTIDRUG AND TOXIC COMPOUND EXTRUSION PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsMATE2

Oryzabase Gene Name Synonym(s)

Multidrug and Toxic compound Extrusion protein 2

Transcript Evidence

KC631818.1 (IR64)

Inferred from literature

Protein Evidence

R4SEW1

Literature

PMID: 30121733

PMID: 24492654

Note

Manual Curation

August 22, 2018

Gene Ontology (GO)

Biological Process: drug transmembrane transport (GO:0006855)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: drug transmembrane transporter activity (GO:0015238)

Molecular Function: antiporter activity (GO:0015297)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Multi antimicrobial extrusion protein (IPR002528)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Others

Oryzabase (15521)

Transcript

2046 bp

>Os05t0554000-03 Multidrug and toxic compound extrusion (MATE) protein family transporter, Arsenic stress response, Regulation of plant growth and development, Disease resistance
ACAGACACCAAAGCCGTCTCTGAGAAGAAGAGAGGGAGAGAGAGAGAGAGAGAGAGAGCT
CGGTCGGTGGAGGCGACGACGACGACGCGCGCACTGCGGCCGCCATGGAGGAGAGAATAC
CTCTGCTCTCGAAACGATTCCCGGCGGACGGCACCGCCGGAGTGGGAGGAGGGAGGGAGG
AGGAGGGCGGAGATAGGTGGTGGAGCGGGCTGGCGCGGGAGGCAGGAAAGGTGGGGTCCA
TGGCGCTGCCCATGGCCGCGATGAGCGTGGCGCAGAACGCCGTGCAGGTGGCGTCCAACA
TGATGGTGGGGCACCTCCCCGGCGTCCTCCCGCTCTCCGCCTCCGCCATCGCCACCTCCC
TCGCCAGCGTCTCCGGCTTCAGCCTCCTCGTTGGAATGGCAAGTGGATTAGAAACTCTCT
GCGGTCAAGCTTATGGGGCAAAACAGTATGACAAGTTAGGAGTGCAAACCTACAGAGCAA
TAGTCACACTAACAGTAGTCACAATTCCCATCTCACTTCTATGGGTATTCATAGGCAAAC
TCTTGACCCTAATAGGTCAGGACCCCGTGATCTCACATGAAGCTGGAAGATACATAGTGT
GGTTGATTCCAGGACTCTTCGCATACGCGGTCTGCCAGCCTCTCACAAAATTTCTGCAGT
CTCAGAGTCTAATATTTCCCATGCTCTGGTCCTCCATTGCAACTCTGCTCCTGCACATCC
CTCTGTCTTGGCTGTTGGTGTTCAAGACCAGCATGGGATTTACTGGAGCTGCTTTAGCAA
TTAGCATATCTTACTGGTTGAATACATTCATGCTCGCTGCATACATCAGATTCTCATGTT
CTTGTAAGGTGACTCGCTCGCCTCCTACAATCGAGGCATTCAGAGGAGTCGGTTTGTTTC
TGCGAATAGCACTACCATCTGCACTAATGTTATGTTTTGAATGGTGGTCATTTGAGATCC
TTGTTCTCCTGTCAGGACTTCTACCCAACCCAGAGCTTGAAAGTTCAGTTCTTTCCATAT
GCTTGACGACTACCTCTTTGATGTATACTATACCATATGGTCTTGGAGGCGCTGCAAGCA
CTCGAGTAGCAAATGAGTTAGGCGCTGGGAATCCTGAAGGAGCTCGATCGGCTGTTCACC
TTGTAATGTCTATTGCTGGGACAGAGGCAGTTCTTGTTACTGGGATGCTGTTTGCAGCAC
AGCGCATCTTGGGCTATGCTTACAGCAGTGATGAGGAGGTTGTCACATATTTCACCTCAA
TGGTTCCTTTTGTGTGCATCTCAGTTGCTGCTGATAGCCTACAAGGAGTTTTATCAGGTA
TTGCTCGGGGTTGCGGATGGCAGCACCTGGGAGCCTATGTAAACCTCGGTTCATTCTACC
TGGTTGGCATTCCGGTAGCCCTACTTCTTGGCTTTGGTTTCAAGATGGAAGGCAAAGGGC
TTTGGCTGGGCATCGCCTGTGGTTCCGTATTACAATTCTTGCTTCTCGCCGTCATTGCAT
TCTTCAGCAACTGGCAAAAGATGGCCGAGAAAGCGAGGGAGAGAATTTTCGGCGAGACAC
CGTCAGAGAAGCAACATTTGGTGCTTGATGCAACGAATTCGGTCTGATTCTGCATCCTGA
TCCGTTGACGCGAACTGAAGCGGATGATCGGATCATGTGGAGGAGACTGGCTCCTCTGGA
TGTGTAGGGAATCTGCTGAAGAAGTAAAGCAGTGTGCATAGTTGTACTGTTGCATTTGTT
GGATCCGGGAGAATGTATCAAGAACTCTATGTGAAATGTATGATGGCGATATGTATGTAC
GAGATCGAGGTTCCGAATACTTCCAGCCTATAGAAGTATAGATAAATTTTCCACTCTTCG
TGGACAGAAAGAATAAAAGGCTAATCTTCTCTCGGAAAATGAGGCTAACCTCTTCTGAAT
GACTTATCATAACTTCGCCAAATACCAAAAAAGGCTTTTTTTTTTTACATCATACAGCGT
AATTACATATTTACATGTAATTGATGCATGATCAGGCATTCCAAGGATCACACTCCTTTT
GGCAAA

CDS

1503 bp

>Os05t0554000-03 Multidrug and toxic compound extrusion (MATE) protein family transporter, Arsenic stress response, Regulation of plant growth and development, Disease resistance
ATGGAGGAGAGAATACCTCTGCTCTCGAAACGATTCCCGGCGGACGGCACCGCCGGAGTG
GGAGGAGGGAGGGAGGAGGAGGGCGGAGATAGGTGGTGGAGCGGGCTGGCGCGGGAGGCA
GGAAAGGTGGGGTCCATGGCGCTGCCCATGGCCGCGATGAGCGTGGCGCAGAACGCCGTG
CAGGTGGCGTCCAACATGATGGTGGGGCACCTCCCCGGCGTCCTCCCGCTCTCCGCCTCC
GCCATCGCCACCTCCCTCGCCAGCGTCTCCGGCTTCAGCCTCCTCGTTGGAATGGCAAGT
GGATTAGAAACTCTCTGCGGTCAAGCTTATGGGGCAAAACAGTATGACAAGTTAGGAGTG
CAAACCTACAGAGCAATAGTCACACTAACAGTAGTCACAATTCCCATCTCACTTCTATGG
GTATTCATAGGCAAACTCTTGACCCTAATAGGTCAGGACCCCGTGATCTCACATGAAGCT
GGAAGATACATAGTGTGGTTGATTCCAGGACTCTTCGCATACGCGGTCTGCCAGCCTCTC
ACAAAATTTCTGCAGTCTCAGAGTCTAATATTTCCCATGCTCTGGTCCTCCATTGCAACT
CTGCTCCTGCACATCCCTCTGTCTTGGCTGTTGGTGTTCAAGACCAGCATGGGATTTACT
GGAGCTGCTTTAGCAATTAGCATATCTTACTGGTTGAATACATTCATGCTCGCTGCATAC
ATCAGATTCTCATGTTCTTGTAAGGTGACTCGCTCGCCTCCTACAATCGAGGCATTCAGA
GGAGTCGGTTTGTTTCTGCGAATAGCACTACCATCTGCACTAATGTTATGTTTTGAATGG
TGGTCATTTGAGATCCTTGTTCTCCTGTCAGGACTTCTACCCAACCCAGAGCTTGAAAGT
TCAGTTCTTTCCATATGCTTGACGACTACCTCTTTGATGTATACTATACCATATGGTCTT
GGAGGCGCTGCAAGCACTCGAGTAGCAAATGAGTTAGGCGCTGGGAATCCTGAAGGAGCT
CGATCGGCTGTTCACCTTGTAATGTCTATTGCTGGGACAGAGGCAGTTCTTGTTACTGGG
ATGCTGTTTGCAGCACAGCGCATCTTGGGCTATGCTTACAGCAGTGATGAGGAGGTTGTC
ACATATTTCACCTCAATGGTTCCTTTTGTGTGCATCTCAGTTGCTGCTGATAGCCTACAA
GGAGTTTTATCAGGTATTGCTCGGGGTTGCGGATGGCAGCACCTGGGAGCCTATGTAAAC
CTCGGTTCATTCTACCTGGTTGGCATTCCGGTAGCCCTACTTCTTGGCTTTGGTTTCAAG
ATGGAAGGCAAAGGGCTTTGGCTGGGCATCGCCTGTGGTTCCGTATTACAATTCTTGCTT
CTCGCCGTCATTGCATTCTTCAGCAACTGGCAAAAGATGGCCGAGAAAGCGAGGGAGAGA
ATTTTCGGCGAGACACCGTCAGAGAAGCAACATTTGGTGCTTGATGCAACGAATTCGGTC
TGA

Protein

501 aa

>Os05t0554000-03 Multidrug and toxic compound extrusion (MATE) protein family transporter, Arsenic stress response, Regulation of plant growth and development, Disease resistance
MEERIPLLSKRFPADGTAGVGGGREEEGGDRWWSGLAREAGKVGSMALPMAAMSVAQNAV
QVASNMMVGHLPGVLPLSASAIATSLASVSGFSLLVGMASGLETLCGQAYGAKQYDKLGV
QTYRAIVTLTVVTIPISLLWVFIGKLLTLIGQDPVISHEAGRYIVWLIPGLFAYAVCQPL
TKFLQSQSLIFPMLWSSIATLLLHIPLSWLLVFKTSMGFTGAALAISISYWLNTFMLAAY
IRFSCSCKVTRSPPTIEAFRGVGLFLRIALPSALMLCFEWWSFEILVLLSGLLPNPELES
SVLSICLTTTSLMYTIPYGLGGAASTRVANELGAGNPEGARSAVHLVMSIAGTEAVLVTG
MLFAAQRILGYAYSSDEEVVTYFTSMVPFVCISVAADSLQGVLSGIARGCGWQHLGAYVN
LGSFYLVGIPVALLLGFGFKMEGKGLWLGIACGSVLQFLLLAVIAFFSNWQKMAEKARER
IFGETPSEKQHLVLDATNSV*

5'UTR

chr05:27542126..27542229 (+ strand) : 104 bp

CDS

chr05:27542230..27542514 (+ strand) : 285 bp

chr05:27543221..27543765 (+ strand) : 545 bp

chr05:27543876..27543962 (+ strand) : 87 bp

chr05:27544055..27544111 (+ strand) : 57 bp

chr05:27544202..27544440 (+ strand) : 239 bp

chr05:27545233..27545438 (+ strand) : 206 bp

chr05:27545551..27545634 (+ strand) : 84 bp

3'UTR

chr05:27545635..27546073 (+ strand) : 439 bp

FASTA

>Os05t0554000-03 class=Sequence position=chr05:27542126..27546073 (+ strand)
ACAGACACCA AAGCCGTCTC TGAGAAGAAG AGAGGGAGAG AGAGAGAGAG AGAGAGAGCT CGGTCGGTGG AGGCGACGAC
GACGACGCGC GCACTGCGGC CGCCATGGAG GAGAGAATAC CTCTGCTCTC GAAACGATTC CCGGCGGACG GCACCGCCGG
AGTGGGAGGA GGGAGGGAGG AGGAGGGCGG AGATAGGTGG TGGAGCGGGC TGGCGCGGGA GGCAGGAAAG GTGGGGTCCA
TGGCGCTGCC CATGGCCGCG ATGAGCGTGG CGCAGAACGC CGTGCAGGTG GCGTCCAACA TGATGGTGGG GCACCTCCCC
GGCGTCCTCC CGCTCTCCGC CTCCGCCATC GCCACCTCCC TCGCCAGCGT CTCCGGCTTC AGCCTCCTCG TACGTCGTCA
TCGCATATCC TGATTTCCCC ACTCGTTCAC GCGTCCTCGA TTTGCTTATA TCCATATTTG TTGCCTGCGT GATTTGGTCT
CATTGGATTA ACTGTTTAGC ACTTTAGCCA GAGAGGCACG TTTCACGGTT TCAGATATTG TTCAATGTGG CGTTCAAATT
TAGCAGTAGG AGGACAGGCA AAAAGTTTAG CCGTACAAGC GGCTGGTTAG TTTGGAAGGG GGATTTTGAT TGGAACAGTG
CCTAAAATTT TTGCTGGAAT ACTGTTTGAA CATTTGGCGT GTTCCAAACA TTCTGAAATA AATCATGGAT ATAGCATAGT
AAGTAGCAGA TTTTTTTTTT TTGGGTATAC AAGTAGCAGT TTGCAAACCT ACAAAATTTA AAATCAACGT TCTCCTAAAT
ATAGAGATAA ATAACAAGTT ACACTACTAG TCTACTACTC CACGCTGAAT GCTTTTCTAG GATGAATTTT AAATTGCCTG
CACAGATGGT GAGCTAGTCA ATTGTCACGA TTTCAACTAG CTTTCAGAAT CTGCGAAGTG TGTACAGCCT AGAGGACTAC
TTCGATACTC TGGCGAAATA TTCTGTAGGA TTTTTTTTTT TTACTTTTCT CTTCAGTTGT ACACGGATTG CCTTTTTAGT
TTGTGATCTT AATTTTGAAA CCACCCATAA TTTGAATTTT GAACTTGTAA AACAGGTTGG AATGGCAAGT GGATTAGAAA
CTCTCTGCGG TCAAGCTTAT GGGGCAAAAC AGTATGACAA GTTAGGAGTG CAAACCTACA GAGCAATAGT CACACTAACA
GTAGTCACAA TTCCCATCTC ACTTCTATGG GTATTCATAG GCAAACTCTT GACCCTAATA GGTCAGGACC CCGTGATCTC
ACATGAAGCT GGAAGATACA TAGTGTGGTT GATTCCAGGA CTCTTCGCAT ACGCGGTCTG CCAGCCTCTC ACAAAATTTC
TGCAGTCTCA GAGTCTAATA TTTCCCATGC TCTGGTCCTC CATTGCAACT CTGCTCCTGC ACATCCCTCT GTCTTGGCTG
TTGGTGTTCA AGACCAGCAT GGGATTTACT GGAGCTGCTT TAGCAATTAG CATATCTTAC TGGTTGAATA CATTCATGCT
CGCTGCATAC ATCAGATTCT CATGTTCTTG TAAGGTGACT CGCTCGCCTC CTACAATCGA GGCATTCAGA GGAGTCGGTT
TGTTTCTGCG AATAGCACTA CCATCTGCAC TAATGTTATG GTAATTACAG TAGCTTCAGA ATCTCCTTGT TTTATATGTA
AGTATTTCTT ATTTCCTGTT AAAAAATTCC CACTTATTGG ATTAATGGAT TTTCTTCTAT TATTTTGTAG TTTTGAATGG
TGGTCATTTG AGATCCTTGT TCTCCTGTCA GGACTTCTAC CCAACCCAGA GCTTGAAAGT TCAGTTCTTT CCATATGGTA
AGAAAATAAG AGTCCTCAAT GTCGCACTTA ACAATATATT CTCTTATAGC TGCACCTTTT GTTATTTTAT AAGCACTCCA
TTTATGCAGC TTGACGACTA CCTCTTTGAT GTATACTATA CCATATGGTC TTGGAGGCGC TGCAAGGTAG AAGCCAAACC
ACTACTGTGA ATGATTATTT TTTCTCAGAG AATAATCATG TGTTAACAGC CTTGTGAATT TTGTTTTAAT GAACAGCACT
CGAGTAGCAA ATGAGTTAGG CGCTGGGAAT CCTGAAGGAG CTCGATCGGC TGTTCACCTT GTAATGTCTA TTGCTGGGAC
AGAGGCAGTT CTTGTTACTG GGATGCTGTT TGCAGCACAG CGCATCTTGG GCTATGCTTA CAGCAGTGAT GAGGAGGTTG
TCACATATTT CACCTCAATG GTTCCTTTTG TGTGCATCTC AGTTGCTGCT GATAGCCTAC AAGGAGTTTT ATCAGGTTAC
ATTTCCTAAC ATTTGATTTA TCTGTTAATT ATTCATTCCC TTCAAAAGAA TGGAAAAAAT GGAGTATTCA GCTATGCCTG
AAGTTTTCGA AAATTTGATC TAACTGGCCT TGCCTCTCTC TTATTTCATT TTTTTTATAT AACTGGTTCT TATAGTTTTG
GGGCCATTAC ATTTACACCA TTCAGTATCT TTAGCCTGTT AGCCCAACGG TATCTTTTAC CCCTTAGTTT GATTGCTTAA
TTCAATGTGT GCGCTGTTGT CAAATCTCTA CCAAGACCTC AGGTAGCAAG TTAATTTCAG TCACTCCGGT ATCGTAAAGA
CATACCAGGT AACTTGCCGC TTCTTGTTTT TCCTTTGTTC AATGAAACTA ATGCTATTTT GTGTTGTGGA GGCCGACATT
GTTACTCGGG GAGTTACCTG TTTGTTCCTT CAAACATGTG CTCTTACGTG AACATGGATA TGGTGGTGTT TACAATCAAC
ACGCATCTAT CAGCGATGTC GTCTTAAGTG TGGACTCCAC TTCACTAAGT ATGCAATTAC ACCTTTCCCC TGGCTAGTGG
TAGACTGGTA GTGTGGCACT GGTGTTTGCT TCACAGGTCT ATTTCATTGT TTGTGCTTCT GAGCAGTTGT GGACATGCCA
AAAACAATGA ACTGAACTTG CGAAAACACA CATCTCATTC AGCTCCAGCA CGGAAACATA CTATTGTTTC TCCTCTCTAG
AAGATTATAT CAAGATAGAT GCACCACACG TCATTGCTTA ACACTGACAG ATATTACTTG TTATCAGGTA TTGCTCGGGG
TTGCGGATGG CAGCACCTGG GAGCCTATGT AAACCTCGGT TCATTCTACC TGGTTGGCAT TCCGGTAGCC CTACTTCTTG
GCTTTGGTTT CAAGATGGAA GGCAAAGGGC TTTGGCTGGG CATCGCCTGT GGTTCCGTAT TACAATTCTT GCTTCTCGCC
GTCATTGCAT TCTTCAGCAA CTGGCAAAAG ATGGTTTGTT TCTTTATCTG AAACTCCAAG CCTTCTCCCC AACATCATCA
AATCTTGATC ACTCGAAAAC TGAATCATGT TTCTCCCGCC TACTGACCTG ATGCTGCTTC TGCAGGCCGA GAAAGCGAGG
GAGAGAATTT TCGGCGAGAC ACCGTCAGAG AAGCAACATT TGGTGCTTGA TGCAACGAAT TCGGTCTGAT TCTGCATCCT
GATCCGTTGA CGCGAACTGA AGCGGATGAT CGGATCATGT GGAGGAGACT GGCTCCTCTG GATGTGTAGG GAATCTGCTG
AAGAAGTAAA GCAGTGTGCA TAGTTGTACT GTTGCATTTG TTGGATCCGG GAGAATGTAT CAAGAACTCT ATGTGAAATG
TATGATGGCG ATATGTATGT ACGAGATCGA GGTTCCGAAT ACTTCCAGCC TATAGAAGTA TAGATAAATT TTCCACTCTT
CGTGGACAGA AAGAATAAAA GGCTAATCTT CTCTCGGAAA ATGAGGCTAA CCTCTTCTGA ATGACTTATC ATAACTTCGC
CAAATACCAA AAAAGGCTTT TTTTTTTTAC ATCATACAGC GTAATTACAT ATTTACATGT AATTGATGCA TGATCAGGCA
TTCCAAGGAT CACACTCCTT TTGGCAAA

Locus: Os05g0554000

Loading...

Locus: Os05g0554000

Loading...