Os05t0554400-02

Locus

Os05g0554400

Description

Similar to Phosphatidylserine synthase 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SUI2

CGSNL Gene Name

SHORTENED UPPERMOST INTERNODE 2

Oryzabase Gene Symbol Synonym(s)

OsSUI2

Oryzabase Gene Name Synonym(s)

Shortened Uppermost Internode 2

Transcript Evidence

AK102948 (DDBJ, Best hit)

Protein Evidence

B6SVL1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: phosphatidylserine biosynthetic process (GO:0006659)

Functional domain (InterPro)

Phosphatidyl serine synthase (IPR004277)

Full-length cDNA

J033115B22 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0554400-02)

RiceXPro (AK102948)

Others

Oryzabase (19639)

KEGG (Os05t0554400-02 (EC:2.7.8.-))

Transcript

2461 bp

>Os05t0554400-02 Similar to Phosphatidylserine synthase 2.
GGGCTCTGAAGTAATCCTTCGCTTCTGCTTCTTTCTTCTTCTGCATGTCCTGTCTGTCCC
CCTCGTCTCGTCTCGTCTCGTCTCGTCTCTTGCTTTCGCCTCTCCTGACCTGACCGCGAC
AATCCGTGGTGGTTATATCGCGCAGGCGCTTCGCTTGGTTTGGCGTGTTGTTTGGCTGCC
GCGGCAGTTTTCTCCTGTCACATATCGCAGAGGGTTCTGGAAGTGGGAACATGGAGGCGA
AGCAGAGGACGAGGCATCGCGACGGAGAGGAGAGGAGGCTCGTAGCGGCGGCGGATGGCG
GCGCCGAGGAGTACGACCCATGGACGGCGTGGCTCTACAAGCCGCACACCATCTCGGTGC
TCCTCGTCGGTGCTTGCCTTCTAATTTGGGCAAGTGGAGCGCTTGATCCAGAGGGTGCTT
CTTATCACAGTAGTGCGACATCTATTAAGAGGGGTGTCTGGGCTATGATTGCAGTCTTCC
TTGCTTACTGCACTCTCCAAGCACCTTCAACGATACTTATTAGGCCCCATCCTGCTGTCT
GGCGCCTGGTGCACGGACTGGCTGTCGTTTACCTTGTCGCTCTAGCCTTTCTTCTTTTCC
AGAACCGCGATGATGCTCGCCAGTTCATGAAACACCTTTACCCTGATCTTGGAGTTGAAT
TGCCGGAGAGATCTTATGGAGCTGACTGCCGTCTGTATGTTCCGGAAAACCCTAAAAACA
AGTTCATAAATATTTATGTATGATTTTTCATTTGAACCTTCCTATTTCATGCTCTGGTTT
TTGTTATTATTGTAGTTATTATCATTGTTATTACCCCATCATATTTGACGGTTTGATATA
CATATAGGAGACATTATTTGACGAATTTGTGGTTGCCCATATTTTGGGTTGGTGGGGTAA
AGCCGTAATGATACGAAACCAGCTTCTTCTTTGGGTCCTCTCGATTGGTTTCGAGCTAAT
GGAGGTTAGATATGGTTACTCAACCTTTTGTTATCTTTTACTTGTTATCTCTAACAAGGT
ATTGTGCTTATTATGACCTTTTGCAGCTTACATTCAGACATATGTTGCCAAACTTTAATG
AGTGCTGGTGGGATAGTATTATTTTGGATATCTTGATCTGCAACTGGTTTGGTAGGACAA
TCGGAGACAGCTGACTTTCATGTTGTATACATTCAGTGACATTGATGATACATTTTTTAC
ATCTAAAGTTATTAGTAAAACAAAGTTAGGCAGATTAAAATAATATAGTGTTTTTGGGTT
TGCATATTTTATACAGTTTGTTTGGATCTAACTCTTATCAACTGAACATGATAATATAGA
AAATGAATAGCGATGTGATGTATCTGAGAGTTTTAAGAAGAAAACTTAGACCTGATGCAC
ATGCATACTGCTGACATTAAACACTTACTGTTTATGAAGTAATATAATTTATCTTCTTCT
ATCAGTTCATGGGTTGAAAGCAATCTTTCTATTTCAGTAACCAGTTATTGAAAGAGTACC
TGCATATGCACGTTAGGGTCAAAAGTGACAAGTAAATGTGAATGGAGGAAGAACAAATCT
GCCATATAAGCCTCACTCTTAGCAGTAGGCTATGGAGTGTTTTATGTGTTCAGCTTCATC
TAAATATTTTGGCTGAAATGCTAATATTCTTATTCAGGTATATGGGCGGGGATGCACACA
GTCCGTTACTTTGACGGTAAAACATATGAGTGGGTTGGACTGAGCCGACAGCCAAGCATC
ATGGGCAAGGTGAAAAGATCACTGAGCCAGTTCACCCCTGCACAATGGGACAAGGATCAA
TGGTACCCTTTCATGGGGCCGTTGCGGTTCGTTCAAGTGTTGTTCCTGTGCGTTGTTTTC
ATGACAGTGGAGCTCAACACATTTTTTCTTAAATTTTGCCTCTGGATTCCTCCAAGGAAT
CCTTTGGTTGTGTACAGATTAATCCTATGGTGGTTGATTGCTATTCCAACCATCCGTGAG
TACAACTCCTACTTGCAAAACAGCAAACCGGTGAAGAAGGTTGGGGCTTTTTGCTGGCTC
TCTCTAGCTATATGCATTGTAGAGCTTCTTATATGTATGAAGTTTGGACATGGGCTGTTT
CATGATCCCATGCCTACTTGGTTGATCATCTTTTGGAGTTCGGTGGGGGTAGCACTAGTG
GTTTTCTTGCTTGCATGGTCTTGGAGGAATCACCTGAAATATCAGAGAAAGCGGCTATAA
TGGATTAATTTTTCGGAAGATTTTCGACTCTGGACCCCCTTCAAACTTGTTTCTTCTTCT
TGATAGGATGTACATATGTGATGGGTGATGATGTAACTTAAATGTGATGGGTAATTATGT
AACTTTAAATCCTAGGATAAAGCAATTTTCAGCTACATTTCACATTATGTTTTACAATAG
CCAATTGTTGCCTCGCAAGAGGGATGGCTAATTTCAGATTAATAAGTGAAATATTACCAT
G

CDS

513 bp

>Os05t0554400-02 Similar to Phosphatidylserine synthase 2.
ATGGAGGCGAAGCAGAGGACGAGGCATCGCGACGGAGAGGAGAGGAGGCTCGTAGCGGCG
GCGGATGGCGGCGCCGAGGAGTACGACCCATGGACGGCGTGGCTCTACAAGCCGCACACC
ATCTCGGTGCTCCTCGTCGGTGCTTGCCTTCTAATTTGGGCAAGTGGAGCGCTTGATCCA
GAGGGTGCTTCTTATCACAGTAGTGCGACATCTATTAAGAGGGGTGTCTGGGCTATGATT
GCAGTCTTCCTTGCTTACTGCACTCTCCAAGCACCTTCAACGATACTTATTAGGCCCCAT
CCTGCTGTCTGGCGCCTGGTGCACGGACTGGCTGTCGTTTACCTTGTCGCTCTAGCCTTT
CTTCTTTTCCAGAACCGCGATGATGCTCGCCAGTTCATGAAACACCTTTACCCTGATCTT
GGAGTTGAATTGCCGGAGAGATCTTATGGAGCTGACTGCCGTCTGTATGTTCCGGAAAAC
CCTAAAAACAAGTTCATAAATATTTATGTATGA

Protein

171 aa

>Os05t0554400-02 Similar to Phosphatidylserine synthase 2.
MEAKQRTRHRDGEERRLVAAADGGAEEYDPWTAWLYKPHTISVLLVGACLLIWASGALDP
EGASYHSSATSIKRGVWAMIAVFLAYCTLQAPSTILIRPHPAVWRLVHGLAVVYLVALAF
LLFQNRDDARQFMKHLYPDLGVELPERSYGADCRLYVPENPKNKFINIYV*

5'UTR

chr05:27552949..27553178 (+ strand) : 230 bp

CDS

chr05:27553179..27553333 (+ strand) : 155 bp

chr05:27554049..27554114 (+ strand) : 66 bp

chr05:27554295..27554354 (+ strand) : 60 bp

chr05:27554749..27554839 (+ strand) : 91 bp

chr05:27555217..27555271 (+ strand) : 55 bp

chr05:27555361..27555446 (+ strand) : 86 bp

3'UTR

chr05:27555447..27556452 (+ strand) : 1006 bp

chr05:27556996..27557249 (+ strand) : 254 bp

chr05:27557346..27557434 (+ strand) : 89 bp

chr05:27557852..27558220 (+ strand) : 369 bp

FASTA

>Os05t0554400-02 class=Sequence position=chr05:27552949..27558220 (+ strand)
GGGCTCTGAA GTAATCCTTC GCTTCTGCTT CTTTCTTCTT CTGCATGTCC TGTCTGTCCC CCTCGTCTCG TCTCGTCTCG
TCTCGTCTCT TGCTTTCGCC TCTCCTGACC TGACCGCGAC AATCCGTGGT GGTTATATCG CGCAGGCGCT TCGCTTGGTT
TGGCGTGTTG TTTGGCTGCC GCGGCAGTTT TCTCCTGTCA CATATCGCAG AGGGTTCTGG AAGTGGGAAC ATGGAGGCGA
AGCAGAGGAC GAGGCATCGC GACGGAGAGG AGAGGAGGCT CGTAGCGGCG GCGGATGGCG GCGCCGAGGA GTACGACCCA
TGGACGGCGT GGCTCTACAA GCCGCACACC ATCTCGGTGC TCCTCGTCGG TGCTTGCCTT CTAATGTAAG TGCTCTTCCA
CGATTAAATT TCACAAATTC GTTTTTATTT TTTTTTCTCG CTTTGCTGCC TCTGCCTGTG ACTTAAGGGC TAAGGCTGTA
AATTTCTTGG TGGGAGAACT GGAAAAAAAG GCCTTGTTGT GTTGGGGCAA AGTACAATTC AACAGATGCC AGGGCTTCTG
CCTATCAGGT GCATCAACAG TGTCAGAGTT GAAAGCAGGG CATGTAGTAC TCATTGTGAT TTTTTTACTT TCTCTGAAAG
AAAAAGGTGA AATTTTTGGG TCGGGAAATT TAGTGATTTT GTGCCAGCAA GTTGAGGTTT CTGAATGATT GAACGAACAT
GAAAGCATGG CAGTCTGGTT CAGCAAGGCT AGCAAACAAC CGAGCGTACG AGTGGCTGAG GAGAATCGGA ATCATGTTCA
AGAATCTCGT GCGAAAGCTT CCCTAGAACA ATCATTTTTT CCCATATCAT TTTTAGCAGG TGCAAATTAC ATGGGAAGTA
CATTCCTCTC GTCCCTTTTT TTTAACTGTA GAAACGGCTC ACCAAGAACT TTATTGTTGC TATTGCTTCA TGAAAGGATT
AAGCATATAA CTTTGTGTCT GAAACAACCA TTAGCTAGGC TAGGCTGTTG AGTGGTTGGT TGTGAACTTG CTGGGGCGTT
CTCCTTTTCA CTTTCTCGTG GTGCTGTCTG ATTTCATGTT CAATCATGTT CCCGTTTCAG TTGGGCAAGT GGAGCGCTTG
ATCCAGAGGG TGCTTCTTAT CACAGTAGTG CGACATCTAT TAAGAGGTAA TGACCGAAAA CCTTTTTTTT TTACTTTACT
GGAAAGTGAT GCAATCATCT AAGGGAACTC TGGTTACTTC TCTACTTTGA TTGTGTCTTT TGGACTTGAG CTGTTCTCCT
CTCACCACTG CACAATGATT GGGAGAGAGT GACACTGACT CATATTTTCT CACTGACACT CTCCAGGGGT GTCTGGGCTA
TGATTGCAGT CTTCCTTGCT TACTGCACTC TCCAAGCACC TTCAACGTGA GTTAGCCCCC CTCTTCTTAT ATGTATTTCA
AACATTGGAA CTATGTTAGT GCAGTGGCTG TCGTTGTCAG GCATTTTTCT TTAAGTAGGG AAATTGAAGG TTTTCTGCTT
CAAAGAGGTG ACCCACGTGT TACTGTATGA GTGAGACCAT ATAGTGGCCA ATTCTCTTGA AAGTGTAGGG CTTATTATTC
GTCAGGTTGT TTTTAATGGT GACACAAAAA TTACCTTGAG GGACCCAATA CCAATGCCAT TCTCATGCTG TTTTTGTACT
TGCTACTTTT GTCTTCTTTA TCTCCTTGGG TTCATAACAA TTTGAGAACC TGTAAATCTA CTGTGCATCT CTAATATTTT
TGCATGATGA TGATTCAATG TTCTGGCAAT ATTGTCACAG GATACTTATT AGGCCCCATC CTGCTGTCTG GCGCCTGGTG
CACGGACTGG CTGTCGTTTA CCTTGTCGCT CTAGCCTTTC TTCTTTTCCA GGTTAGTTGT TACTATTGAA AAATTCATAC
ATCGATAAAG TAGGACAAAA AATGCCCTTT CAATAATATC CCATGCACGT AAAATGTTAG AAAATGGCGG GAGATGTCTA
TTATTCATAG GGTTATTTTG GGAAGTTCTT ACAGGAGCGT GAAGTGGCAA GTATTTGTGA AAGAAAAAAC TTGAGATCCA
AGCAAATGCA AATTGTCTTG TCAAAAAAAA AAGTTGGAAG TCTTGTATCC AAACTATTTG ATTATCAAAA TTCAGTATAA
ATGGCATTTT TTCAAGACTC TTGAGCGAGG GGCCTCAACT ACGTAGAGAT ATGCTACATC TTGGATATCT TGTACTGTAA
TAATTCTTAT TTCTTTCTCG TTTTCCAGAA CCGCGATGAT GCTCGCCAGT TCATGAAACA CCTTTACCCT GATCTTGGAG
TTGGTAATAT CTTTACATCG AAAGGATTTA CACTGGAAAT TAAATATTGT AGAAGAAATG GTGCTGACAA ACATTTCTGT
ACACTAATGC AGAATTGCCG GAGAGATCTT ATGGAGCTGA CTGCCGTCTG TATGTTCCGG AAAACCCTAA AAACAAGTTC
ATAAATATTT ATGTATGATT TTTCATTTGA ACCTTCCTAT TTCATGCTCT GGTTTTTGTT ATTATTGTAG TTATTATCAT
TGTTATTACC CCATCATATT TGACGGTTTG ATATACATAT AGGAGACATT ATTTGACGAA TTTGTGGTTG CCCATATTTT
GGGTTGGTGG GGTAAAGCCG TAATGATACG AAACCAGCTT CTTCTTTGGG TCCTCTCGAT TGGTTTCGAG CTAATGGAGG
TTAGATATGG TTACTCAACC TTTTGTTATC TTTTACTTGT TATCTCTAAC AAGGTATTGT GCTTATTATG ACCTTTTGCA
GCTTACATTC AGACATATGT TGCCAAACTT TAATGAGTGC TGGTGGGATA GTATTATTTT GGATATCTTG ATCTGCAACT
GGTTTGGTAG GACAATCGGA GACAGCTGAC TTTCATGTTG TATACATTCA GTGACATTGA TGATACATTT TTTACATCTA
AAGTTATTAG TAAAACAAAG TTAGGCAGAT TAAAATAATA TAGTGTTTTT GGGTTTGCAT ATTTTATACA GTTTGTTTGG
ATCTAACTCT TATCAACTGA ACATGATAAT ATAGAAAATG AATAGCGATG TGATGTATCT GAGAGTTTTA AGAAGAAAAC
TTAGACCTGA TGCACATGCA TACTGCTGAC ATTAAACACT TACTGTTTAT GAAGTAATAT AATTTATCTT CTTCTATCAG
TTCATGGGTT GAAAGCAATC TTTCTATTTC AGTAACCAGT TATTGAAAGA GTACCTGCAT ATGCACGTTA GGGTCAAAAG
TGACAAGTAA ATGTGAATGG AGGAAGAACA AATCTGCCAT ATAAGCCTCA CTCTTAGCAG TAGGCTATGG AGTGTTTTAT
GTGTTCAGCT TCATCTAAAT ATTTTGGCTG AAATGCTAAT ATTCTTATTC AGGTATATGG GCGGGGATGC ACACAGTCCG
TTACTTTGAC GGTAAAACAT ATGAGTGGGT TGGACTGAGC CGACAGCCAA GCATCATGGG CAAGGTATGT TACCAAACAA
ACAAATTGTT TCTTATTTGC AAATAGGTTA GTACCTTTTT TTAGGACTGT TCTTTTAATC TTCATTCATC ATGGCCCTTA
GGCCTAGATT TTTTTTTTGT ACCTGCTGAA TTTTCCTGGG CTATTGTGCT TTTTGTAAGA ATTTCCTCAT CGATTCTTTC
TTGAGTTACG ACTTACAAGA GCCTCTTGCT ACTGCTAAGT CCATGGGAGC ATTCTATAAC AATGCAGTCG CTGAGCAAAA
GTAAATCACT TTGACTTCTT GTCTGTAGTA CGCCAAACAA CATGTGAGGT TTTCCCAGTG GGACTGTATT GATTTCTGTT
GCTCTGTCCA AACTCTAAAC TGTCAATTGC CATTATTGAT ACCTGACTTC ATAATTTATT TTGTTGTATA CCATTCTGGC
ATTCAGTGTG TTTTATCTGA TTGGACTATA TGCACATTTG TGCAGTTACA TTCTGCTTCA GACTGCATAC TATAGTTAGG
TTGAACCCAT TTACAGTTTA CCGACCTTCC TTTACTTGCA TATGCAGGTG AAAAGATCAC TGAGCCAGTT CACCCCTGCA
CAATGGGACA AGGATCAATG GTACCCTTTC ATGGGGCCGT TGCGGTTCGT TCAAGTGTTG TTCCTGTGCG TTGTTTTCAT
GACAGTGGAG CTCAACACAT TTTTTCTTAA ATTTTGCCTC TGGATTCCTC CAAGGAATCC TTTGGTTGTG TACAGATTAA
TCCTATGGTG GTTGATTGCT ATTCCAACCA TCCGTGAGTA CAACTCCTAC TTGCAAAACA GGTTATCCCA ATTTCCCTGC
ACGCCCAATA GCATTGCACA TTTTTTACAA TTTTACTTAA TGGCTTGCTA ATATATATTT TTTCATGGTC ACACCAGCAA
ACCGGTGAAG AAGGTTGGGG CTTTTTGCTG GCTCTCTCTA GCTATATGCA TTGTAGAGCT TCTTATATGT ATGAAGTTTG
GACATGGTGA GTTACTCTCT TCTGACATCA TCATCACTTG TGAAATAATT GATCTGATTT GAAAAATTAC CTTATGGTCG
CTTGATTTTC TCGTGATATA TACtactccc tccggttcta taataattaa cgttttggac aaagttaagg tcaaactttt
ataactttga ccatcaataa ctttaaaaat atttagttta aagaaactag aacaacatat atagatttgt ctttcaaaac
actataataa aagtaaacat gtatttattt attgtatata ttataataga aaaataagat caaaggtata ttttgtagac
cgtgtcattg tctaaaacat caattaaaat gaaaccggag ggagtaGTAT ATATTTGGAA CATTAAATGT TAAGAGTGCC
TAACTTTTTT GTAATCTGGA TAGGGCTGTT TCATGATCCC ATGCCTACTT GGTTGATCAT CTTTTGGAGT TCGGTGGGGG
TAGCACTAGT GGTTTTCTTG CTTGCATGGT CTTGGAGGAA TCACCTGAAA TATCAGAGAA AGCGGCTATA ATGGATTAAT
TTTTCGGAAG ATTTTCGACT CTGGACCCCC TTCAAACTTG TTTCTTCTTC TTGATAGGAT GTACATATGT GATGGGTGAT
GATGTAACTT AAATGTGATG GGTAATTATG TAACTTTAAA TCCTAGGATA AAGCAATTTT CAGCTACATT TCACATTATG
TTTTACAATA GCCAATTGTT GCCTCGCAAG AGGGATGGCT AATTTCAGAT TAATAAGTGA AATATTACCA TG