Os05t0555600-01

Locus

Os05g0555600

Description

Similar to Glutamate synthase [NADH], amyloplastic.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GLT2

CGSNL Gene Name

NADH-DEPENDENT GLUTAMATE SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

OsGLT2, OsNADH-GOGAT2, NADH-GOGAT2, OsGOGAT2

Oryzabase Gene Name Synonym(s)

NADH-glutamate synthase 2, NADH-dependent glutamate synthase2, NADH-dependent glutamate synthase 2

Transcript Evidence

AK070485 (DDBJ, Best hit)

Protein Evidence

Q03460 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: glutamate biosynthetic process (GO:0006537)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor (GO:0016639)

Molecular Function: iron-sulfur cluster binding (GO:0051536)

Functional domain (InterPro)

Glutamate synthase, alpha subunit, C-terminal (IPR002489)

Glutamate synthase, NADH/NADPH, small subunit 1 (IPR006005)

Alpha-helical ferredoxin (IPR009051)

Fumarate reductase, C-terminal (IPR012285)

Pyridine nucleotide-disulphide oxidoreductase, FAD/NAD(P)-binding domain (IPR023753)

Full-length cDNA

J023049P18 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0555600-01)

Others

Oryzabase (9312)

Transcript

2257 bp

>Os05t0555600-01 Similar to Glutamate synthase [NADH], amyloplastic.
TTGCTTATGTTTATGATGTGGATGGGAAGTTCAGTAGCCGTTGCAACTATGAGCTAGTTG
ACTTGTATGCTGTAGTTGAAGAGGATGACATCACAACATTGAGAATGATGATACAACAGC
ACAGACTTCATACACAAAGTGATTTGGCCAGAGATATACTCTTGAATTTTGATACTCTCC
TCCCAAAATTTATAAAAGTATATCCAAGGGattacaagcgggttttggataaactaaaag
aagagaaggctgctaaagaagcagagcaaaaggcaagagaagtggtggatAAGAAGCCAG
TTGAAGTAATTCAAGCTCCAAATGGCATTTCAGTAAAGACAGAGAAAGTAATGAACGAAG
AGCCATCAAGCCGACCATCACGAGTTTCAAATGCTGTAAAGTACCGAGGTTTCATAAAAT
ATGAGCGAGAGGGTACTTCTTACAGAGATCCAAATGAGCGTGTAAAAGATTGGAATGAAG
TTGCAATTGAATTGGTTCCTGGGCCACTGCTAAAGACGCAATCTGCTCGGTGCATGGATT
GTGGCACTCCTTTCTGTCATCAGGAGGGTTCTGGTGCTGGTTGTCCTCTTGGAAATAAGA
TTCCTGAATTCAATGAATTGGTTCATCAGAATAGATGGCATGAAGCCTTGGATCGGCTAC
TTGAGACAAACAATTTCCCTGAGTTTACTGGACGAGTTTGTCCTGCTCCTTGTGAGGGTT
CGTGCGTACTTGGCATTATAGACAATCCAGTATCCATAAAAAGCATAGAGTGCGCCATCA
TAGACAAAGGATTTGAAGAGGGATGGATGGTACCACGGCCTCCACTTCGGAGAACAGGAA
AGAGAGTTGCTATTGTTGGCAGTGGCCCAGCTGGTCTAGCTGCTGCAGACCAACTGAACA
AAATGGGCCATTTCGTGACTGTCTTTGAACGTGCTGACCGTATTGGAGGACTGATGATGT
ATGGGGTTCCAAATATGAAGGCTGACAAAGAGGGCATTGTTCAGCGACGTGTCGAGTTGA
TGGCTAAGGAGGGGGTTCAATTCATTGTGAATGCCCATGTTGGAAGTGACCCTTTATACT
CCGTTGAAAAGCTCCGCTCTGAGAATGATGCCATTATTTTGGCCTGTGGAGCTACAAAGC
CAAAAGATCTCCCTATTCCTGGACGGGAGTTGGCAGGCATCCATTTCGCTATGGAATTTC
TTCATGCCAATACCAAAAGTTTACTTGACAGCAACTTGGAGGATGGTAACTACATATCAG
CCCAAGGGAGAAAGGTGGTTGTCATTGGTGGTGGAGACACAGGCACAGATTGCATTGGGA
CATCCATTAGGCATGGTTGCACCAACCTTGTAAATCTTGAACTTTTGCCAGAGCCACCAA
GAAAGAGGGCACCTGACAACCCCTGGCCCCAGTGGCCCAGGATCTTCCGTGTTGATTATG
GGCACCAGGAAGCAACTAGCAAGTTTGGAAAAGATCCAAGAAGTTACAAAGTCCTGACGA
AGCGATTTATCGGAGATGAGAATGGAAATGTGAAGGCCCTTGAGGTAATACGTGTTGAAT
GGGGAAAGGTGAACGGAAGGTTCCAATTCAAGGAAGTTGAAGGATCAGAAGAAATTATTG
AGGCCGATCTTGTCCTCTTAGCTATGGGATTCCTGGGTCCCGAAGCGACTGTTGCTAACA
AGCTGGGTCTAGAACAAGACATGAGGTCAAACTTCAAAGCTCAATTTGGAAACTTTGCGA
CCAATGTGGAAGGTGTATTTGCTGCTGGAGACTGCAGACGTGGGCAATCACTGGTTGTTT
GGGCCATCACAGAGGGGCGCCAAGCTGCAGCAGCCGTAGACAATTACCTGTCGAAGGATG
ATGAAGGTGAAACCAATGGCACAGAGGACATTGCTGTCTCAAGTGAAGGTCTGGTCCAAC
CCGTAGTTGCATAGGCCGAGAGAACATTTCTGCAATTTTGATACAGCATTGATGATGCGA
AGATAGTAGGGCCATGCATTTTTTAGCTATAAAAAGGTAAAATAAAGGGCCTGTAAATAA
TTTACAAGAAAAGGGGGCCCTTTTGTTTATATAAGTATGATAAAAGGGAAATTTTGCGGA
CGCGTATATTTTTTCCCTGTTTCTTCTTGTGAAGAGATGCAAATCCTGTGATTATAAGAG
CAATGTCTGGTTTTTGTTAAATAAATGTGAGGGGATTCTGTTAAAAACATCTATTTATTA
TGTGTAAGTACATAATGGATCTTCGTGTTTCTCTTCC

CDS

1932 bp

>Os05t0555600-01 Similar to Glutamate synthase [NADH], amyloplastic.
GCTTATGTTTATGATGTGGATGGGAAGTTCAGTAGCCGTTGCAACTATGAGCTAGTTGAC
TTGTATGCTGTAGTTGAAGAGGATGACATCACAACATTGAGAATGATGATACAACAGCAC
AGACTTCATACACAAAGTGATTTGGCCAGAGATATACTCTTGAATTTTGATACTCTCCTC
CCAAAATTTATAAAAGTATATCCAAGGGattacaagcgggttttggataaactaaaagaa
gagaaggctgctaaagaagcagagcaaaaggcaagagaagtggtggatAAGAAGCCAGTT
GAAGTAATTCAAGCTCCAAATGGCATTTCAGTAAAGACAGAGAAAGTAATGAACGAAGAG
CCATCAAGCCGACCATCACGAGTTTCAAATGCTGTAAAGTACCGAGGTTTCATAAAATAT
GAGCGAGAGGGTACTTCTTACAGAGATCCAAATGAGCGTGTAAAAGATTGGAATGAAGTT
GCAATTGAATTGGTTCCTGGGCCACTGCTAAAGACGCAATCTGCTCGGTGCATGGATTGT
GGCACTCCTTTCTGTCATCAGGAGGGTTCTGGTGCTGGTTGTCCTCTTGGAAATAAGATT
CCTGAATTCAATGAATTGGTTCATCAGAATAGATGGCATGAAGCCTTGGATCGGCTACTT
GAGACAAACAATTTCCCTGAGTTTACTGGACGAGTTTGTCCTGCTCCTTGTGAGGGTTCG
TGCGTACTTGGCATTATAGACAATCCAGTATCCATAAAAAGCATAGAGTGCGCCATCATA
GACAAAGGATTTGAAGAGGGATGGATGGTACCACGGCCTCCACTTCGGAGAACAGGAAAG
AGAGTTGCTATTGTTGGCAGTGGCCCAGCTGGTCTAGCTGCTGCAGACCAACTGAACAAA
ATGGGCCATTTCGTGACTGTCTTTGAACGTGCTGACCGTATTGGAGGACTGATGATGTAT
GGGGTTCCAAATATGAAGGCTGACAAAGAGGGCATTGTTCAGCGACGTGTCGAGTTGATG
GCTAAGGAGGGGGTTCAATTCATTGTGAATGCCCATGTTGGAAGTGACCCTTTATACTCC
GTTGAAAAGCTCCGCTCTGAGAATGATGCCATTATTTTGGCCTGTGGAGCTACAAAGCCA
AAAGATCTCCCTATTCCTGGACGGGAGTTGGCAGGCATCCATTTCGCTATGGAATTTCTT
CATGCCAATACCAAAAGTTTACTTGACAGCAACTTGGAGGATGGTAACTACATATCAGCC
CAAGGGAGAAAGGTGGTTGTCATTGGTGGTGGAGACACAGGCACAGATTGCATTGGGACA
TCCATTAGGCATGGTTGCACCAACCTTGTAAATCTTGAACTTTTGCCAGAGCCACCAAGA
AAGAGGGCACCTGACAACCCCTGGCCCCAGTGGCCCAGGATCTTCCGTGTTGATTATGGG
CACCAGGAAGCAACTAGCAAGTTTGGAAAAGATCCAAGAAGTTACAAAGTCCTGACGAAG
CGATTTATCGGAGATGAGAATGGAAATGTGAAGGCCCTTGAGGTAATACGTGTTGAATGG
GGAAAGGTGAACGGAAGGTTCCAATTCAAGGAAGTTGAAGGATCAGAAGAAATTATTGAG
GCCGATCTTGTCCTCTTAGCTATGGGATTCCTGGGTCCCGAAGCGACTGTTGCTAACAAG
CTGGGTCTAGAACAAGACATGAGGTCAAACTTCAAAGCTCAATTTGGAAACTTTGCGACC
AATGTGGAAGGTGTATTTGCTGCTGGAGACTGCAGACGTGGGCAATCACTGGTTGTTTGG
GCCATCACAGAGGGGCGCCAAGCTGCAGCAGCCGTAGACAATTACCTGTCGAAGGATGAT
GAAGGTGAAACCAATGGCACAGAGGACATTGCTGTCTCAAGTGAAGGTCTGGTCCAACCC
GTAGTTGCATAG

Protein

644 aa

>Os05t0555600-01 Similar to Glutamate synthase [NADH], amyloplastic.
AYVYDVDGKFSSRCNYELVDLYAVVEEDDITTLRMMIQQHRLHTQSDLARDILLNFDTLL
PKFIKVYPRDYKRVLDKLKEEKAAKEAEQKAREVVDKKPVEVIQAPNGISVKTEKVMNEE
PSSRPSRVSNAVKYRGFIKYEREGTSYRDPNERVKDWNEVAIELVPGPLLKTQSARCMDC
GTPFCHQEGSGAGCPLGNKIPEFNELVHQNRWHEALDRLLETNNFPEFTGRVCPAPCEGS
CVLGIIDNPVSIKSIECAIIDKGFEEGWMVPRPPLRRTGKRVAIVGSGPAGLAAADQLNK
MGHFVTVFERADRIGGLMMYGVPNMKADKEGIVQRRVELMAKEGVQFIVNAHVGSDPLYS
VEKLRSENDAIILACGATKPKDLPIPGRELAGIHFAMEFLHANTKSLLDSNLEDGNYISA
QGRKVVVIGGGDTGTDCIGTSIRHGCTNLVNLELLPEPPRKRAPDNPWPQWPRIFRVDYG
HQEATSKFGKDPRSYKVLTKRFIGDENGNVKALEVIRVEWGKVNGRFQFKEVEGSEEIIE
ADLVLLAMGFLGPEATVANKLGLEQDMRSNFKAQFGNFATNVEGVFAAGDCRRGQSLVVW
AITEGRQAAAAVDNYLSKDDEGETNGTEDIAVSSEGLVQPVVA*

5'UTR

chr05:27631211..27631212 (+ strand) : 2 bp

CDS

chr05:27631213..27631554 (+ strand) : 342 bp

chr05:27631708..27631926 (+ strand) : 219 bp

chr05:27634248..27634522 (+ strand) : 275 bp

chr05:27634615..27634920 (+ strand) : 306 bp

chr05:27635069..27635336 (+ strand) : 268 bp

chr05:27635486..27635740 (+ strand) : 255 bp

chr05:27635861..27636127 (+ strand) : 267 bp

3'UTR

chr05:27636128..27636450 (+ strand) : 323 bp

FASTA

>Os05t0555600-01 class=Sequence position=chr05:27631211..27636450 (+ strand)
TTGCTTATGT TTATGATGTG GATGGGAAGT TCAGTAGCCG TTGCAACTAT GAGCTAGTTG ACTTGTATGC TGTAGTTGAA
GAGGATGACA TCACAACATT GAGAATGATG ATACAACAGC ACAGACTTCA TACACAAAGT GATTTGGCCA GAGATATACT
CTTGAATTTT GATACTCTCC TCCCAAAATT TATAAAAGTA TATCCAAGGG attacaagcg ggttttggat aaactaaaag
aagagaaggc tgctaaagaa gcagagcaaa aggcaagaga agtggtggat AAGAAGCCAG TTGAAGTAAT TCAAGCTCCA
AATGGCATTT CAGTAAAGAC AGAGGTAAAT AAGGTTTAAG CAGGATTATT TCTCATTCTC TATATCGGTG ATATTTAACT
TGACTGTTGG AAATTTATGA TGTCCTTCTT AAAATAGTTA TTATTGTAAT TCTGTAAGCT AAGCTTTCTA GTCTGACTTA
AAGTCTTTGA TATGCAGAAA GTAATGAACG AAGAGCCATC AAGCCGACCA TCACGAGTTT CAAATGCTGT AAAGTACCGA
GGTTTCATAA AATATGAGCG AGAGGGTACT TCTTACAGAG ATCCAAATGA GCGTGTAAAA GATTGGAATG AAGTTGCAAT
TGAATTGGTT CCTGGGCCAC TGCTAAAGAC GCAATCTGCT CGGTGCATGG ATTGTGGCAC TCCTTTCTGT CATCAGGTGA
TACTCAGTTT TTTTCCCTTT TGTATTAAGC AGTTTTTTTT CATAAAATAC AATGATGCTT TTCAGTACAG TAGTTTTATA
TGAATGTCAC CCGGCAAAAA AGTTTTATAT GAATGTCCTT GATGCTCTTG ATTTCTTGTC CATATATATT AGTGCATATA
GTCGTGCATT CGCACGAATT TAACCATCCT CTATACTGAA TATCTTTACA TATTATTTGT AGTAACAAAA TATACTTCCC
tttttaatag atgacactgt taacttttaa cataatattt aatcattcat cttattaaaa aatattatgt aaatgttaat
ttttttggtc tgacttgttt tatcattACT GCGTTATGAT ATTTTGGTAA GTTGGCAATG GTAGGGTATG CTTAGTTAGT
TACCCTATAA AATTTGGTAT TTTTTTCTAT TTTATTTAAT TTTTAGGTAA ACTAAATTCA TAATATTTTA CTTTACTTTA
GAAAGTGTGT TCGTTGAAAA AAAAACTGAG ATGGTTAATT TGTGTGCTAA ACAAAACCGA CAATCGAGTG TACTTTATGC
AATGTTTAAA AAAGTGTGTA AAGAATATAA TCTATctatt atattattaa aggaatagaa aaagaagcct ccacgttcgc
tctcatggcc tagaaattct cacattaatc ggagaaaaag aaaagacaga gtccatatag aaatacaatt tagaaatagc
tgaaatttgg aattaaaaaa taaggaatat tagaagagga gactagagtc catatagaaa tacaatttag aaatagttga
aattcggaat taaaaaataa ggaatattag aagaggagac tagagtccat atagaaatac aattaggaaa taactgaaat
tcggaattaa aaagaaggaa tattcgaagt agagtataga gtccatatag aaatacaatt aggaaataac tcaaattcgg
aattaaaaaa taaggaatat tagaaaagga gactagagtc catatagaaa tataatttaa aattagttga aattcggaat
taaaaaataa ggaatattag aagaggagac tagagtccat atagaaatac aattaggaaa taactgatat tcggaattaa
aaataaggaa tattagaagt agagtataga gtccatatag aaatacaatt agaaaataat agaaaatcgg aattaaaaat
aatgaatatt agaagtagag tatatagtcc atatagaaat acaattaaga aaaaaaataa attcggaatt aaaaaataag
gaatattaga agtagagtat agagtccata taggaattta aaactaacta aaattcagaa taaacataat aaaattaaaa
gtagagttta gagtctgtat aaaaatacaa tttacaaata actaaaattc gagattaaga aaaacatgga aagaagagtt
taaagtcaat ataggaatac aatttagaag taactgaaat tcgaaattaa aaattaaaga atattgaaag ataagtttag
agtccacata gaaatacaat tagaaataat aaaaattcag aaataaaaat aaataatatt ggaagaagag cctagagtct
atatagaaat acaatttaca gaaaatttgg aattaaaaaa atatattaaa agatgagtct agagtccata taggaatata
tatattttac aaataactaa aatttgatat taaaaataat taataactaa cacgtatata aaatacaata tgaatattac
acattagtag tttcgtaaag ttattgcaaa atctaaaatt atgttgtcat tttaatatat ttggataata tattgagaaa
acatatatgc tattatatga gagaaaatat aatgatgcta gccgcgcaat ctgcgcggga caccatgcta gtttcaatag
taaaaCTCAA AACTTTCAAG GTTCTTCACG TATACGAGGT TTTAATTGTA CACAAGGTAT AAAAATAATT TACCAATATT
CAAAACTCAA AACCTCCAAA ATTATACGCC TAAGAAAAAA ATATTTTTTA GGCTTAAAAA TAAAAAGGTG CCATGGTTGT
GACATATTGG CAGGTTCAGA GGTGGACTTG GAATATCTAG TAACTTCCTT GCCACTCTTC CATCGGACAG CTGAGATTTA
TTCTTCAGTT TTTGTCCTTT TATCGATTCT ATGGCCATTA TTTACTACAT GATGTGGCTT TTTCTCTTTG CATCATCAGA
TTGTCTTTTC ACTTGTTAAG ATTTGTGAAA TTTTCTTGGT ATGGTTCCTG TATTTTTCTT ATATCAAACT TTTGCAGGAG
GGTTCTGGTG CTGGTTGTCC TCTTGGAAAT AAGATTCCTG AATTCAATGA ATTGGTTCAT CAGAATAGAT GGCATGAAGC
CTTGGATCGG CTACTTGAGA CAAACAATTT CCCTGAGTTT ACTGGACGAG TTTGTCCTGC TCCTTGTGAG GGTTCGTGCG
TACTTGGCAT TATAGACAAT CCAGTATCCA TAAAAAGCAT AGAGTGCGCC ATCATAGACA AAGGATTTGA AGAGGGATGG
ATGGTACCAC GGCCTCCACT TCGGAGAACA GGGTGTGTGT TCGGCACAAC TTTGTACTTG CTTTCTTATA TGAGTTGAAG
CATGTAACAA TAGCTGCACC TAAAGCTACT TCATTTTTTT GCAGAAAGAG AGTTGCTATT GTTGGCAGTG GCCCAGCTGG
TCTAGCTGCT GCAGACCAAC TGAACAAAAT GGGCCATTTC GTGACTGTCT TTGAACGTGC TGACCGTATT GGAGGACTGA
TGATGTATGG GGTTCCAAAT ATGAAGGCTG ACAAAGAGGG CATTGTTCAG CGACGTGTCG AGTTGATGGC TAAGGAGGGG
GTTCAATTCA TTGTGAATGC CCATGTTGGA AGTGACCCTT TATACTCCGT TGAAAAGCTC CGCTCTGAGA ATGATGCCAT
TATTTTGGCC TGTGGAGCTA CAAAGCCAAA GTGAGTTAAT ACAAAAACGA AAAAAAGAAG AGTTTGTAAC TCTAGTTTAC
ATCTTTCTTG GCACCAGTTT TTAAAGTCTA AGCAACACAG TCTATATCAT TCATGCCTTT GAAACTTGGC TAATGTTTAG
AGCATTATCC TTGAGCAGAG ATCTCCCTAT TCCTGGACGG GAGTTGGCAG GCATCCATTT CGCTATGGAA TTTCTTCATG
CCAATACCAA AAGTTTACTT GACAGCAACT TGGAGGATGG TAACTACATA TCAGCCCAAG GGAGAAAGGT GGTTGTCATT
GGTGGTGGAG ACACAGGCAC AGATTGCATT GGGACATCCA TTAGGCATGG TTGCACCAAC CTTGTAAATC TTGAACTTTT
GCCAGAGCCA CCAAGAAAGA GGGCACCTGA CAACCCCTGG CCCCAGGTTA GTTCCCTCAT CATATAAAAC AACAGCATCT
TTATATTCTT TTTTTAGTGA AAATCTTTGT ATGTTTAGAA TGTAAGCATT GCGCCACTAC GGTTGCCTGA AATTCCACTA
ACATTACTCT GTTGTGTTTC TACTATTGCC TTCAGTGGCC CAGGATCTTC CGTGTTGATT ATGGGCACCA GGAAGCAACT
AGCAAGTTTG GAAAAGATCC AAGAAGTTAC AAAGTCCTGA CGAAGCGATT TATCGGAGAT GAGAATGGAA ATGTGAAGGC
CCTTGAGGTA ATACGTGTTG AATGGGGAAA GGTGAACGGA AGGTTCCAAT TCAAGGAAGT TGAAGGATCA GAAGAAATTA
TTGAGGCCGA TCTTGTCCTC TTAGCTATGG GATTCCTGGG TCCCGAAGCG GTTAGTTTTC CTCCCTTTCT CTTATGAGTT
ATGACAAGAA TAGCATTACA CAATTGTGCA CATAGCTATC TGTTTAGAGA CCAACCAACA CATAGTGCCT AACTGCATAT
CCTTCTACAG ACTGTTGCTA ACAAGCTGGG TCTAGAACAA GACATGAGGT CAAACTTCAA AGCTCAATTT GGAAACTTTG
CGACCAATGT GGAAGGTGTA TTTGCTGCTG GAGACTGCAG ACGTGGGCAA TCACTGGTTG TTTGGGCCAT CACAGAGGGG
CGCCAAGCTG CAGCAGCCGT AGACAATTAC CTGTCGAAGG ATGATGAAGG TGAAACCAAT GGCACAGAGG ACATTGCTGT
CTCAAGTGAA GGTCTGGTCC AACCCGTAGT TGCATAGGCC GAGAGAACAT TTCTGCAATT TTGATACAGC ATTGATGATG
CGAAGATAGT AGGGCCATGC ATTTTTTAGC TATAAAAAGG TAAAATAAAG GGCCTGTAAA TAATTTACAA GAAAAGGGGG
CCCTTTTGTT TATATAAGTA TGATAAAAGG GAAATTTTGC GGACGCGTAT ATTTTTTCCC TGTTTCTTCT TGTGAAGAGA
TGCAAATCCT GTGATTATAA GAGCAATGTC TGGTTTTTGT TAAATAAATG TGAGGGGATT CTGTTAAAAA CATCTATTTA
TTATGTGTAA GTACATAATG GATCTTCGTG TTTCTCTTCC 

Locus: Os05g0555600

Loading...

Locus: Os05g0555600

Loading...