Os05t0555600-02

Locus

Os05g0555600

Description

Similar to NADH-glutamate synthase 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GLT2

CGSNL Gene Name

NADH-DEPENDENT GLUTAMATE SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

OsGLT2, OsNADH-GOGAT2, NADH-GOGAT2, OsGOGAT2

Oryzabase Gene Name Synonym(s)

NADH-glutamate synthase 2, NADH-dependent glutamate synthase2, NADH-dependent glutamate synthase 2

Transcript Evidence

AK071893 (DDBJ, Best hit)

Protein Evidence

Q93WZ7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: glutamate biosynthetic process (GO:0006537)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor (GO:0016639)

Molecular Function: iron-sulfur cluster binding (GO:0051536)

Functional domain (InterPro)

Glutamate synthase, NADH/NADPH, small subunit 1 (IPR006005)

Alpha-helical ferredoxin (IPR009051)

Fumarate reductase, C-terminal (IPR012285)

Pyridine nucleotide-disulphide oxidoreductase, FAD/NAD(P)-binding domain (IPR023753)

Full-length cDNA

J013053K07 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0555600-02)

RiceXPro (AK071893)

Others

Oryzabase (9312)

KEGG (Os05t0555600-02 (EC:1.4.1.13, EC:1.4.1.14))

Transcript

1792 bp

>Os05t0555600-02 Similar to NADH-glutamate synthase 2.
TTTCATAAAATATGAGCGAGAGGGTACTTCTTACAGAGATCCAAATGAGCGTGTAAAAGA
TTGGAATGAAGTTGCAATTGAATTGGTTCCTGGGCCACTGCTAAAGACGCAATCTGCTCG
GTGCATGGATTGTGGCACTCCTTTCTGTCATCAGGAGGGTTCTGGTGCTGGTTGTCCTCT
TGGAAATAAGATTCCTGAATTCAATGAATTGGTTCATCAGAATAGATGGCATGAAGCCTT
GGATCGGCTACTTGAGACAAACAATTTCCCTGAGTTTACTGGACGAGTTTGTCCTGCTCC
TTGTGAGGGTTCGTGCGTACTTGGCATTATAGACAATCCAGTATCCATAAAAAGCATAGA
GTGCGCCATCATAGACAAAGGATTTGAAGAGGGATGGATGGTACCACGGCCTCCACTTCG
GAGAACAGGAAAGAGAGTTGCTATTGTTGGCAGTGGCCCAGCTGGTCTAGCTGCTGCAGA
CCAACTGAACAAAATGGGCCATTTCGTGACTGTCTTTGAACGTGCTGACCGTATTGGAGG
ACTGATGATGTATGGGGTTCCAAATATGAAGGCTGACAAAGAGGGCATTGTTCAGCGACG
TGTCGAGTTGATGGCTAAGGAGGGGGTTCAATTCATTGTGAATGCCCATGTTGGAAGTGA
CCCTTTATACTCCGTTGAAAAGCTCCGCTCTGAGAATGATGCCATTATTTTGGCCTGTGG
AGCTACAAAGCCAAAAGATCTCCCTATTCCTGGACGGGAGTTGGCAGGCATCCATTTCGC
TATGGAATTTCTTCATGCCAATACCAAAAGTTTACTTGACAGCAACTTGGAGGATGGTAA
CTACATATCAGCCCAAGGGAGAAAGGTGGTTGTCATTGGTGGTGGAGACACAGGCACAGA
TTGCATTGGGACATCCATTAGGCATGGTTGCACCAACCTTGTAAATCTTGAACTTTTGCC
AGAGCCACCAAGAAAGAGGGCACCTGACAACCCCTGGCCCCAGTGGCCCAGGATCTTCCG
TGTTGATTATGGGCACCAGGAAGCAACTAGCAAGTTTGGAAAAGATCCAAGAAGTTACAA
AGTCCTGACGAAGCGATTTATCGGAGATGAGAATGGAAATGTGAAGGCCCTTGAGGTAAT
ACGTGTTGAATGGGGAAAGGTGAACGGAAGGTTCCAATTCAAGGAAGTTGAAGGATCAGA
AGAAATTATTGAGGCCGATCTTGTCCTCTTAGCTATGGGATTCCTGGGTCCCGAAGCGAC
TGTTGCTAACAAGCTGGGTCTAGAACAAGACATGAGGTCAAACTTCAAAGCTCAATTTGG
AAACTTTGCGACCAATGTGGAAGGTGTATTTGCTGCTGGAGACTGCAGACGTGGGCAATC
ACTGGTTGTTTGGGCCATCACAGAGGGGCGCCAAGCTGCAGCAGCCGTAGACAATTACCT
GTCGAAGGATGATGAAGGTGAAACCAATGGCACAGAGGACATTGCTGTCTCAAGTGAAGG
TCTGGTCCAACCCGTAGTTGCATAGGCCGAGAGAACATTTCTGCAATTTTGATACAGCAT
TGATGATGCGAAGATAGTAGGGCCATGCATTTTTTAGCTATAAAAAGGTAAAATAAAGGG
CCTGTAAATAATTTACAAGAAAAGGGGGCCCTTTTGTTTATATAAGTATGATAAAAGGGA
AATTTTGCGGACGCGTATATTTTTTCCCTGTTTCTTCTTGTGAAGAGATGCAAATCCTGT
GATTATAAGAGCAATGTCTGGTTTTTGTTAAATAAATGTGAGGGGATTCTGT

CDS

1524 bp

>Os05t0555600-02 Similar to NADH-glutamate synthase 2.
TTCATAAAATATGAGCGAGAGGGTACTTCTTACAGAGATCCAAATGAGCGTGTAAAAGAT
TGGAATGAAGTTGCAATTGAATTGGTTCCTGGGCCACTGCTAAAGACGCAATCTGCTCGG
TGCATGGATTGTGGCACTCCTTTCTGTCATCAGGAGGGTTCTGGTGCTGGTTGTCCTCTT
GGAAATAAGATTCCTGAATTCAATGAATTGGTTCATCAGAATAGATGGCATGAAGCCTTG
GATCGGCTACTTGAGACAAACAATTTCCCTGAGTTTACTGGACGAGTTTGTCCTGCTCCT
TGTGAGGGTTCGTGCGTACTTGGCATTATAGACAATCCAGTATCCATAAAAAGCATAGAG
TGCGCCATCATAGACAAAGGATTTGAAGAGGGATGGATGGTACCACGGCCTCCACTTCGG
AGAACAGGAAAGAGAGTTGCTATTGTTGGCAGTGGCCCAGCTGGTCTAGCTGCTGCAGAC
CAACTGAACAAAATGGGCCATTTCGTGACTGTCTTTGAACGTGCTGACCGTATTGGAGGA
CTGATGATGTATGGGGTTCCAAATATGAAGGCTGACAAAGAGGGCATTGTTCAGCGACGT
GTCGAGTTGATGGCTAAGGAGGGGGTTCAATTCATTGTGAATGCCCATGTTGGAAGTGAC
CCTTTATACTCCGTTGAAAAGCTCCGCTCTGAGAATGATGCCATTATTTTGGCCTGTGGA
GCTACAAAGCCAAAAGATCTCCCTATTCCTGGACGGGAGTTGGCAGGCATCCATTTCGCT
ATGGAATTTCTTCATGCCAATACCAAAAGTTTACTTGACAGCAACTTGGAGGATGGTAAC
TACATATCAGCCCAAGGGAGAAAGGTGGTTGTCATTGGTGGTGGAGACACAGGCACAGAT
TGCATTGGGACATCCATTAGGCATGGTTGCACCAACCTTGTAAATCTTGAACTTTTGCCA
GAGCCACCAAGAAAGAGGGCACCTGACAACCCCTGGCCCCAGTGGCCCAGGATCTTCCGT
GTTGATTATGGGCACCAGGAAGCAACTAGCAAGTTTGGAAAAGATCCAAGAAGTTACAAA
GTCCTGACGAAGCGATTTATCGGAGATGAGAATGGAAATGTGAAGGCCCTTGAGGTAATA
CGTGTTGAATGGGGAAAGGTGAACGGAAGGTTCCAATTCAAGGAAGTTGAAGGATCAGAA
GAAATTATTGAGGCCGATCTTGTCCTCTTAGCTATGGGATTCCTGGGTCCCGAAGCGACT
GTTGCTAACAAGCTGGGTCTAGAACAAGACATGAGGTCAAACTTCAAAGCTCAATTTGGA
AACTTTGCGACCAATGTGGAAGGTGTATTTGCTGCTGGAGACTGCAGACGTGGGCAATCA
CTGGTTGTTTGGGCCATCACAGAGGGGCGCCAAGCTGCAGCAGCCGTAGACAATTACCTG
TCGAAGGATGATGAAGGTGAAACCAATGGCACAGAGGACATTGCTGTCTCAAGTGAAGGT
CTGGTCCAACCCGTAGTTGCATAG

Protein

508 aa

>Os05t0555600-02 Similar to NADH-glutamate synthase 2.
FIKYEREGTSYRDPNERVKDWNEVAIELVPGPLLKTQSARCMDCGTPFCHQEGSGAGCPL
GNKIPEFNELVHQNRWHEALDRLLETNNFPEFTGRVCPAPCEGSCVLGIIDNPVSIKSIE
CAIIDKGFEEGWMVPRPPLRRTGKRVAIVGSGPAGLAAADQLNKMGHFVTVFERADRIGG
LMMYGVPNMKADKEGIVQRRVELMAKEGVQFIVNAHVGSDPLYSVEKLRSENDAIILACG
ATKPKDLPIPGRELAGIHFAMEFLHANTKSLLDSNLEDGNYISAQGRKVVVIGGGDTGTD
CIGTSIRHGCTNLVNLELLPEPPRKRAPDNPWPQWPRIFRVDYGHQEATSKFGKDPRSYK
VLTKRFIGDENGNVKALEVIRVEWGKVNGRFQFKEVEGSEEIIEADLVLLAMGFLGPEAT
VANKLGLEQDMRSNFKAQFGNFATNVEGVFAAGDCRRGQSLVVWAITEGRQAAAAVDNYL
SKDDEGETNGTEDIAVSSEGLVQPVVA*

5'UTR

chr05:27631773..27631773 (+ strand) : 1 bp

CDS

chr05:27631774..27631926 (+ strand) : 153 bp

chr05:27634248..27634522 (+ strand) : 275 bp

chr05:27634615..27634920 (+ strand) : 306 bp

chr05:27635069..27635336 (+ strand) : 268 bp

chr05:27635486..27635740 (+ strand) : 255 bp

chr05:27635861..27636127 (+ strand) : 267 bp

3'UTR

chr05:27636128..27636394 (+ strand) : 267 bp

FASTA

>Os05t0555600-02 class=Sequence position=chr05:27631773..27636394 (+ strand)
TTTCATAAAA TATGAGCGAG AGGGTACTTC TTACAGAGAT CCAAATGAGC GTGTAAAAGA TTGGAATGAA GTTGCAATTG
AATTGGTTCC TGGGCCACTG CTAAAGACGC AATCTGCTCG GTGCATGGAT TGTGGCACTC CTTTCTGTCA TCAGGTGATA
CTCAGTTTTT TTCCCTTTTG TATTAAGCAG TTTTTTTTCA TAAAATACAA TGATGCTTTT CAGTACAGTA GTTTTATATG
AATGTCACCC GGCAAAAAAG TTTTATATGA ATGTCCTTGA TGCTCTTGAT TTCTTGTCCA TATATATTAG TGCATATAGT
CGTGCATTCG CACGAATTTA ACCATCCTCT ATACTGAATA TCTTTACATA TTATTTGTAG TAACAAAATA TACTTCCCtt
tttaatagat gacactgtta acttttaaca taatatttaa tcattcatct tattaaaaaa tattatgtaa atgttaattt
ttttggtctg acttgtttta tcattACTGC GTTATGATAT TTTGGTAAGT TGGCAATGGT AGGGTATGCT TAGTTAGTTA
CCCTATAAAA TTTGGTATTT TTTTCTATTT TATTTAATTT TTAGGTAAAC TAAATTCATA ATATTTTACT TTACTTTAGA
AAGTGTGTTC GTTGAAAAAA AAACTGAGAT GGTTAATTTG TGTGCTAAAC AAAACCGACA ATCGAGTGTA CTTTATGCAA
TGTTTAAAAA AGTGTGTAAA GAATATAATC TATctattat attattaaag gaatagaaaa agaagcctcc acgttcgctc
tcatggccta gaaattctca cattaatcgg agaaaaagaa aagacagagt ccatatagaa atacaattta gaaatagctg
aaatttggaa ttaaaaaata aggaatatta gaagaggaga ctagagtcca tatagaaata caatttagaa atagttgaaa
ttcggaatta aaaaataagg aatattagaa gaggagacta gagtccatat agaaatacaa ttaggaaata actgaaattc
ggaattaaaa agaaggaata ttcgaagtag agtatagagt ccatatagaa atacaattag gaaataactc aaattcggaa
ttaaaaaata aggaatatta gaaaaggaga ctagagtcca tatagaaata taatttaaaa ttagttgaaa ttcggaatta
aaaaataagg aatattagaa gaggagacta gagtccatat agaaatacaa ttaggaaata actgatattc ggaattaaaa
ataaggaata ttagaagtag agtatagagt ccatatagaa atacaattag aaaataatag aaaatcggaa ttaaaaataa
tgaatattag aagtagagta tatagtccat atagaaatac aattaagaaa aaaaataaat tcggaattaa aaaataagga
atattagaag tagagtatag agtccatata ggaatttaaa actaactaaa attcagaata aacataataa aattaaaagt
agagtttaga gtctgtataa aaatacaatt tacaaataac taaaattcga gattaagaaa aacatggaaa gaagagttta
aagtcaatat aggaatacaa tttagaagta actgaaattc gaaattaaaa attaaagaat attgaaagat aagtttagag
tccacataga aatacaatta gaaataataa aaattcagaa ataaaaataa ataatattgg aagaagagcc tagagtctat
atagaaatac aatttacaga aaatttggaa ttaaaaaaat atattaaaag atgagtctag agtccatata ggaatatata
tattttacaa ataactaaaa tttgatatta aaaataatta ataactaaca cgtatataaa atacaatatg aatattacac
attagtagtt tcgtaaagtt attgcaaaat ctaaaattat gttgtcattt taatatattt ggataatata ttgagaaaac
atatatgcta ttatatgaga gaaaatataa tgatgctagc cgcgcaatct gcgcgggaca ccatgctagt ttcaatagta
aaaCTCAAAA CTTTCAAGGT TCTTCACGTA TACGAGGTTT TAATTGTACA CAAGGTATAA AAATAATTTA CCAATATTCA
AAACTCAAAA CCTCCAAAAT TATACGCCTA AGAAAAAAAT ATTTTTTAGG CTTAAAAATA AAAAGGTGCC ATGGTTGTGA
CATATTGGCA GGTTCAGAGG TGGACTTGGA ATATCTAGTA ACTTCCTTGC CACTCTTCCA TCGGACAGCT GAGATTTATT
CTTCAGTTTT TGTCCTTTTA TCGATTCTAT GGCCATTATT TACTACATGA TGTGGCTTTT TCTCTTTGCA TCATCAGATT
GTCTTTTCAC TTGTTAAGAT TTGTGAAATT TTCTTGGTAT GGTTCCTGTA TTTTTCTTAT ATCAAACTTT TGCAGGAGGG
TTCTGGTGCT GGTTGTCCTC TTGGAAATAA GATTCCTGAA TTCAATGAAT TGGTTCATCA GAATAGATGG CATGAAGCCT
TGGATCGGCT ACTTGAGACA AACAATTTCC CTGAGTTTAC TGGACGAGTT TGTCCTGCTC CTTGTGAGGG TTCGTGCGTA
CTTGGCATTA TAGACAATCC AGTATCCATA AAAAGCATAG AGTGCGCCAT CATAGACAAA GGATTTGAAG AGGGATGGAT
GGTACCACGG CCTCCACTTC GGAGAACAGG GTGTGTGTTC GGCACAACTT TGTACTTGCT TTCTTATATG AGTTGAAGCA
TGTAACAATA GCTGCACCTA AAGCTACTTC ATTTTTTTGC AGAAAGAGAG TTGCTATTGT TGGCAGTGGC CCAGCTGGTC
TAGCTGCTGC AGACCAACTG AACAAAATGG GCCATTTCGT GACTGTCTTT GAACGTGCTG ACCGTATTGG AGGACTGATG
ATGTATGGGG TTCCAAATAT GAAGGCTGAC AAAGAGGGCA TTGTTCAGCG ACGTGTCGAG TTGATGGCTA AGGAGGGGGT
TCAATTCATT GTGAATGCCC ATGTTGGAAG TGACCCTTTA TACTCCGTTG AAAAGCTCCG CTCTGAGAAT GATGCCATTA
TTTTGGCCTG TGGAGCTACA AAGCCAAAGT GAGTTAATAC AAAAACGAAA AAAAGAAGAG TTTGTAACTC TAGTTTACAT
CTTTCTTGGC ACCAGTTTTT AAAGTCTAAG CAACACAGTC TATATCATTC ATGCCTTTGA AACTTGGCTA ATGTTTAGAG
CATTATCCTT GAGCAGAGAT CTCCCTATTC CTGGACGGGA GTTGGCAGGC ATCCATTTCG CTATGGAATT TCTTCATGCC
AATACCAAAA GTTTACTTGA CAGCAACTTG GAGGATGGTA ACTACATATC AGCCCAAGGG AGAAAGGTGG TTGTCATTGG
TGGTGGAGAC ACAGGCACAG ATTGCATTGG GACATCCATT AGGCATGGTT GCACCAACCT TGTAAATCTT GAACTTTTGC
CAGAGCCACC AAGAAAGAGG GCACCTGACA ACCCCTGGCC CCAGGTTAGT TCCCTCATCA TATAAAACAA CAGCATCTTT
ATATTCTTTT TTTAGTGAAA ATCTTTGTAT GTTTAGAATG TAAGCATTGC GCCACTACGG TTGCCTGAAA TTCCACTAAC
ATTACTCTGT TGTGTTTCTA CTATTGCCTT CAGTGGCCCA GGATCTTCCG TGTTGATTAT GGGCACCAGG AAGCAACTAG
CAAGTTTGGA AAAGATCCAA GAAGTTACAA AGTCCTGACG AAGCGATTTA TCGGAGATGA GAATGGAAAT GTGAAGGCCC
TTGAGGTAAT ACGTGTTGAA TGGGGAAAGG TGAACGGAAG GTTCCAATTC AAGGAAGTTG AAGGATCAGA AGAAATTATT
GAGGCCGATC TTGTCCTCTT AGCTATGGGA TTCCTGGGTC CCGAAGCGGT TAGTTTTCCT CCCTTTCTCT TATGAGTTAT
GACAAGAATA GCATTACACA ATTGTGCACA TAGCTATCTG TTTAGAGACC AACCAACACA TAGTGCCTAA CTGCATATCC
TTCTACAGAC TGTTGCTAAC AAGCTGGGTC TAGAACAAGA CATGAGGTCA AACTTCAAAG CTCAATTTGG AAACTTTGCG
ACCAATGTGG AAGGTGTATT TGCTGCTGGA GACTGCAGAC GTGGGCAATC ACTGGTTGTT TGGGCCATCA CAGAGGGGCG
CCAAGCTGCA GCAGCCGTAG ACAATTACCT GTCGAAGGAT GATGAAGGTG AAACCAATGG CACAGAGGAC ATTGCTGTCT
CAAGTGAAGG TCTGGTCCAA CCCGTAGTTG CATAGGCCGA GAGAACATTT CTGCAATTTT GATACAGCAT TGATGATGCG
AAGATAGTAG GGCCATGCAT TTTTTAGCTA TAAAAAGGTA AAATAAAGGG CCTGTAAATA ATTTACAAGA AAAGGGGGCC
CTTTTGTTTA TATAAGTATG ATAAAAGGGA AATTTTGCGG ACGCGTATAT TTTTTCCCTG TTTCTTCTTG TGAAGAGATG
CAAATCCTGT GATTATAAGA GCAATGTCTG GTTTTTGTTA AATAAATGTG AGGGGATTCT GT

Locus: Os05g0555600

Loading...

Locus: Os05g0555600

Loading...