Os05t0555600-03

Locus

Os05g0555600

Description

NADH-glutamate synthase, Remobilization of nitrogen in senescing organs

RAP-DB Gene Symbol Synonym(s)

OsNADH-GOGAT2

RAP-DB Gene Name Synonym(s)

NADH-glutamate synthase 2

CGSNL Gene Symbol

GLT2

CGSNL Gene Name

NADH-DEPENDENT GLUTAMATE SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

OsGLT2, OsNADH-GOGAT2, NADH-GOGAT2, OsGOGAT2

Oryzabase Gene Name Synonym(s)

NADH-glutamate synthase 2, NADH-dependent glutamate synthase2, NADH-dependent glutamate synthase 2

Transcript Evidence

AB274818 (Sasanishiki)

Protein Evidence

Q0DG35

Literature

PMID: 24634487

PMID: 22645542

PMID: 17350935

Note

Manual Curation

May 7, 2020

Gene Ontology (GO)

Biological Process: glutamate biosynthetic process (GO:0006537)

Biological Process: nitrogen compound metabolic process (GO:0006807)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: FMN binding (GO:0010181)

Molecular Function: glutamate synthase activity (GO:0015930)

Molecular Function: glutamate synthase (NADH) activity (GO:0016040)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the CH-NH2 group of donors (GO:0016638)

Molecular Function: oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor (GO:0016639)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Molecular Function: iron-sulfur cluster binding (GO:0051536)

Functional domain (InterPro)

Nucleophile aminohydrolases, N-terminal (IPR029055)

Aldolase-type TIM barrel (IPR013785)

Glutamate synthase, alpha subunit, C-terminal domain superfamily (IPR036485)

Alpha-helical ferredoxin (IPR009051)

FAD/NAD(P)-binding domain superfamily (IPR036188)

Glutamate synthase, eukaryotic (IPR012220)

Glutamate synthase, NADH/NADPH, small subunit 1 (IPR006005)

Glutamine amidotransferase type 2 domain (IPR017932)

Glutamate synthase, central-N (IPR006982)

Glutamate synthase domain (IPR002932)

Glutamate synthase, alpha subunit, C-terminal (IPR002489)

Dihydroprymidine dehydrogenase domain II (IPR028261)

FAD/NAD(P)-binding domain (IPR023753)

Others

Oryzabase (9312)

Transcript

6666 bp

>Os05t0555600-03 NADH-glutamate synthase, Remobilization of nitrogen in senescing organs
TACTAGTAGCGGAGGCATTCGTTCCCGCGCGGGCAATGTCGGCGGCGCAGGGCCTTGCGC
TGAAGCTGCGCGCCGCGCCGGCGGCGGGTGGCGTCCGCGGGGAGAAGCGGCGCCGCGCGG
CATCGGCGACCGCGGCGGCGGCGGCGCGGCCTCGCCACGGCGCCATGTCGCTGGAGGGCG
GGTTCCTCGGCGGCGCGCTCCCCGCCGAGGACCGGGTGGCGCCGCGGGCATCGGCGTCGC
GCCAGGCAGAGGCGGGGGCTGGGGCGGGGGCGGCGCGTCCTCCTCCCAGGTCGATGTCGA
AGATCCCCGAGAGCAGCATTGGGCTGTACGACCCCTCCATGGAGCGCGACTCCTGCGGCG
TCGGCTTCATCGCCGAGCTCTCCGGCGAGTACAGCCGCAAAACGGTCGACGACGCCATAG
AGATGCTCGATAGAATGGCTCACCGTGGCGCCTGCGGCTGCGAGAAGAACACCGGAGATG
GCGCAGGCATCCTCGTCGCTCTGCCGCACAACTTCTTCAGAGAGGTCACGAAGGACGCAG
GTTTTGAGCTTCCGCCGCCTGGTGAGTACGCCGTCGGGATGTTTTTCATGCCCACAGATG
ACAAACGCCGTGAAAAGAGCAAGCTTTTGTTTCGTGAGAAAGCAGAGTTGCTGGGGCATA
CCGTCCTCGGCTGGCGCCGGGTTCCCACAGACAACTCGGGCTTGGGTCAATCAGCGGTAG
ATACAGAACCAGTGATTGAGCAAGTGTTTGTCACCAAAAGTGCAAGTTCAAAGGCTGATT
TTGAGCGGCAGATGTACGTCCTACGGAGGTTCTCAGTTATGTCCATACGAGAAGTTCTAG
GCGTCAAGAATGGCGGAACAAAAGATTTCTACATGTGCTCTCTATCTTCAAGGACCATTG
TTTATAAGGGTCAGCTTAAGCCAAGCCAACTCAAGGGGTACTTCTTTGCAGACTTAGGCG
ATGAAAGCTTCACAAGTTACATGGCACTGATCCACTCAAGATTTTCCACGAACACCTTCC
CTAGTTGGGATCGAGCGCAACCAATGCGTGTTTTGGGGCATAATGGCGAGATCAATACCC
TTAGAGGGAACAAGAACTGGATGAAGGCACGTGAGGGTCTCTTGAAGTGCGAGGGACTAG
GTCTAACAAGGGATGAAATGTTGAAACTTCTGCCGATAGTGGATGCTACATCTTCGGATT
CAGGTGCAATCGACAATGTTCTTGAGCTTCTCATACAATCTGGAAGAAGTGCGCCAGAGG
CTGTCATGATGATGATCCCTGAGGCGTGGCAAAACGATGTTAACATGGACCCTGAGAGAA
AAGCTTTGTATGAGTTCTTTTCAGCACTTATGGAGCCTTGGGATGGACCAGCTCTAATCT
CATTTACTGATGGCCGCTACCTTGGTGCAACCCTTGATCGTAATGGTTTGAGGCCAGGCC
GGTTTTATGTGACCTACAGTGGCCGTGTAATTATGGCTAGTGAAGTTGGTGTGGTCGATG
TTCCTCCTCAAGATGTTTCAAGAAAGGGTAGGCTAAACCCTGGAATGATGCTTTTAGTTG
ATTTTGAGAACCATTGTGTTGTGAATGATGATGAATTGAAGAAAGAGTACTCCAAAGTTC
GTCCATATGGAGAGTGGCTGAAAAGACAAAGGATACAACTCACAGATATCATAGAATCTG
TAAATGAAGCAGAGAGAATTGCACCGAGCATTTCGGGTGCACTTCCAATTACAAAGGAGA
ACAAAGCAGATATGGGTATCTGCGGAATTCTGACTCCGCTGAAGGCTTTTGGGTATACAA
GAGAAGCCCTTGAAATGCTGATGCTACCGATGGCCAAAGATGGACAAGAAGCTCTTGGAT
CAATGGGAAATGATACTCCTCTAGCTGTGATGTCAAACAGAGAGAAGCTGACTTTTGAAT
ACTTCAAGCAGATGTTTGCACAAGTTACAAACCCACCGATTGACCCGATCCGGGAGAAAA
TTGTCACATCTATGGAGTGCATGATTGGTCCTGAAGGTGACTTGTCTGAAACAACAGAGC
GGCAGTGCCATCGCCTCACGCTTAAGAGTCCTTTACTGAATACAAATGAAATGGAGGCTA
TTAAAAAGATGAACTACCGGGGTTGGCGCAGCAAGGTGCTTGACATAACTTATCCTAAAA
AGAATGGCAGGATGGGCTTAAAACAGACTTTAGATAAAATTTGTGCTCAAGCACGTGAAG
CTATTCATGAGGGCTACACTATTCTAGTTCTCTCTGATAGAGGTTTTTCTTCAGAGCGTG
TAGCTGTCAGTTCCCTATTGGCAGTTGGAGCTGTCCATCAGCACCTTGTCTCACATCTTG
AGAGGACACGCATAGGATTGTTAGTTGAATCTGCTGAACCTCGCGAAGTGCACCATTTTT
CCACCCTTATTGGATTTGGTGCTGATGCTATATGCCCTTATTTAGCTATAGAAGCAATAT
GGCGGTTGCAAATTGATGGGAGGATTCCTCCTAATGATGGGAAACCTTATACACAAGAAC
AACTTATCGAGAAATATTTTTATGCTTCAAACTATGGAATGATGAAAGTTCTTGCGAAGA
TGGGAATATCCACTCTGGCATCTTACAAAGGTGCTCAGATTTTTGAGGCCCTTGGTCTTG
CTTCGGAAGTGGTCAGCAAGTGTTTTGAAGGTACTCCTAGTAGAGTTGAAGGTGCAACCT
TTGAAATGCTTGCACAAGATGCTCTTCGTCTCCATGAGATTGCATTCCCATCAAGAACTT
TACCTCCTGGAAGTGCAGATGCAAATGCTCTTCCCAACCCTGGGGATTACCATTGGAGGA
AAAATGGAGAAGTACACCTTAATGATCCTTTTTCCATTGCAAAATTACAAGAAGCAGCAC
GGATTAACAGCAGGGAAGCATACAAAGAATATTCTAGGCGCATTTACGAGCTGAATAAGG
CATGTACTCTGCGTGGCATGCTGAAATTTAGAGAAATTCCAAACCAAATTTCCTTGGACG
AGGTAGAACCTGCAAAGGAGATAGTGAAGCGGTTCTGTACTGGAGCAATGAGTTATGGAT
CCATTTCCTTGGAAGCTCATACTTCCCTGGCTGAGGCTATGAACACCCTTGGAGGAAAAT
CTAACACAGGTGAGGGAGGGGAACAACCTTGCCGTATGGTGCCTCTTCCTGATGGATCAA
AGAATCCAAGAATAAGTGCAATCAAGCAAGTTGCCAGCGGAAGATTTGGAGTTTCCATCT
ATTATTTGACTAATGCAGTTGAGGTGCAGATAAAAATGGCTCAGGGTGCTAAACCTGGTG
AAGGTGGTGAGCTACCAGGCCACAAGGTCATTGGTGATATTGCAGTCACTAGAAATTCTA
CAGCTGGTGTAGGGCTCATTAGCCCACCTCCTCACCACGATATATATTCTATTGAGGATC
TCGCACAACTTATCCATGACCTTAAGAATGCAAACCCAGGTGCCAGAATCAGCGTCAAAC
TAGTCTCTGAAGCTGGTGTAGGAATTGTCGCTAGTGGTGTGGTGAAAGGACATGCAGACC
ATGTTCTGATCTCTGGACATGATGGAGGCACTGGAGCCTCCAGATGGACAGGGATTAAAA
ATGCTGGACTTCCTTGGGAGCTTGGATTAGCTGAAACACACCAGACTCTTGTGGCCAATG
GTCTCCGTGGCCGAGCTGTTCTTCAGACAGATGGACAGATGAAAACTGGTAGAGATGTTG
CTGTTGCTTGTTTACTTGGAGCAGAAGAATTTGGATTCAGCACAGCGCCATTAATCACAC
TTGGCTGCATTATGATGAGGAAGTGCCATACCAACACTTGCCCTGCTGGTATTGCTACAC
AAGATCCAGTGCTCCGCGCAAAGTTTGCTGGGAAGCCAGAACATGTCATAAACTACTTCT
TCATGCTTGCTGAAGAGGTACGAGAAATCATGGCACAGCTTGGCTTCCGCACTGTTAATG
AAATGGTTGGGCGATCGGACATGCTTGAGATCGATCCCAAAGTACTGGAGGGCAACGAGA
AACTTGAAAACATTGATCTCTCACGGCTGCTGAAACCAGCTGCTGAAATTAGCCCTGGGG
CTGTTCAATATTGTGTTGAGAAGCAAGATCATGGCCTCGACATGGCATTAGATAACAAAC
TCATAGCCTCCTCAACAGCTGCCCTTCGAAAAGGTGTTCGTGTTTTCATTGAGACACCAG
TACGGAACATTAACCGAGCTGTTGGTACTATGCTCAGCCATGAAGTCACAAAACGGTATC
ACATTCATGGATTGCCATCAGATACCATCCATATTAAGCTGAATGGAAGTGCTGGCCAAA
GTTTTGGTGCTTTTCTCTGTCCTGGGATCACTCTTGAGCTTGAGGGAGACAGCAACGATT
ATGTTGGTAAGGGACTATCTGGTGGAAAGATTGTTGTGTATCCACCAAGAAATAGTCGAT
TTAATCCACAAGACAATATTGTGATTGGTAATGTGGCTTTATATGGTGCTACAAAGGGAG
AGGCATATTTCAATGGTATGGCGGCAGAAAGGTTTTGTGTCCGCAATTCAGGAGCTCAAG
CAGTAGTTGAAGGGATTGGCGATCATGGATGTGAGTACATGACAGGAGGTACAGCTGTTA
TTCTTGGAAAAACTGGTAGGAACTTTGCAGCTGGCATGAGTGGAGGTATTGCTTATGTTT
ATGATGTGGATGGGAAGTTCAGTAGCCGTTGCAACTATGAGCTAGTTGACTTGTATGCTG
TAGTTGAAGAGGATGACATCACAACATTGAGAATGATGATACAACAGCACAGACTTCATA
CACAAAGTGATTTGGCCAGAGATATACTCTTGAATTTTGATACTCTCCTCCCAAAATTTA
TAAAAGTATATCCAAGGGattacaagcgggttttggataaactaaaagaagagaaggctg
ctaaagaagcagagcaaaaggcaagagaagtggtggatAAGAAGCCAGTTGAAGTAATTC
AAGCTCCAAATGGCATTTCAGTAAAGACAGAGAAAGTAATGAACGAAGAGCCATCAAGCC
GACCATCACGAGTTTCAAATGCTGTAAAGTACCGAGGTTTCATAAAATATGAGCGAGAGG
GTACTTCTTACAGAGATCCAAATGAGCGTGTAAAAGATTGGAATGAAGTTGCAATTGAAT
TGGTTCCTGGGCCACTGCTAAAGACGCAATCTGCTCGGTGCATGGATTGTGGCACTCCTT
TCTGTCATCAGGAGGGTTCTGGTGCTGGTTGTCCTCTTGGAAATAAGATTCCTGAATTCA
ATGAATTGGTTCATCAGAATAGATGGCATGAAGCCTTGGATCGGCTACTTGAGACAAACA
ATTTCCCTGAGTTTACTGGACGAGTTTGTCCTGCTCCTTGTGAGGGTTCGTGCGTACTTG
GCATTATAGACAATCCAGTATCCATAAAAAGCATAGAGTGCGCCATCATAGACAAAGGAT
TTGAAGAGGGATGGATGGTACCACGGCCTCCACTTCGGAGAACAGGAAAGAGAGTTGCTA
TTGTTGGCAGTGGCCCAGCTGGTCTAGCTGCTGCAGACCAACTGAACAAAATGGGCCATT
TCGTGACTGTCTTTGAACGTGCTGACCGTATTGGAGGACTGATGATGTATGGGGTTCCAA
ATATGAAGGCTGACAAAGAGGGCATTGTTCAGCGACGTGTCGAGTTGATGGCTAAGGAGG
GGGTTCAATTCATTGTGAATGCCCATGTTGGAAGTGACCCTTTATACTCCGTTGAAAAGC
TCCGCTCTGAGAATGATGCCATTATTTTGGCCTGTGGAGCTACAAAGCCAAAAGATCTCC
CTATTCCTGGACGGGAGTTGGCAGGCATCCATTTCGCTATGGAATTTCTTCATGCCAATA
CCAAAAGTTTACTTGACAGCAACTTGGAGGATGGTAACTACATATCAGCCCAAGGGAGAA
AGGTGGTTGTCATTGGTGGTGGAGACACAGGCACAGATTGCATTGGGACATCCATTAGGC
ATGGTTGCACCAACCTTGTAAATCTTGAACTTTTGCCAGAGCCACCAAGAAAGAGGGCAC
CTGACAACCCCTGGCCCCAGTGGCCCAGGATCTTCCGTGTTGATTATGGGCACCAGGAAG
CAACTAGCAAGTTTGGAAAAGATCCAAGAAGTTACAAAGTCCTGACGAAGCGATTTATCG
GAGATGAGAATGGAAATGTGAAGGCCCTTGAGGTAATACGTGTTGAATGGGGAAAGGTGA
ACGGAAGGTTCCAATTCAAGGAAGTTGAAGGATCAGAAGAAATTATTGAGGCCGATCTTG
TCCTCTTAGCTATGGGATTCCTGGGTCCCGAAGCGACTGTTGCTAACAAGCTGGGTCTAG
AACAAGACATGAGGTCAAACTTCAAAGCTCAATTTGGAAACTTTGCGACCAATGTGGAAG
GTGTATTTGCTGCTGGAGACTGCAGACGTGGGCAATCACTGGTTGTTTGGGCCATCACAG
AGGGGCGCCAAGCTGCAGCAGCCGTAGACAATTACCTGTCGAAGGATGATGAAGGTGAAA
CCAATGGCACAGAGGACATTGCTGTCTCAAGTGAAGGTCTGGTCCAACCCGTAGTTGCAT
AGGCCGAGAGAACATTTCTGCAATTTTGATACAGCATTGATGATGCGAAGATAGTAGGGC
CATGCA

CDS

6567 bp

>Os05t0555600-03 NADH-glutamate synthase, Remobilization of nitrogen in senescing organs
ATGTCGGCGGCGCAGGGCCTTGCGCTGAAGCTGCGCGCCGCGCCGGCGGCGGGTGGCGTC
CGCGGGGAGAAGCGGCGCCGCGCGGCATCGGCGACCGCGGCGGCGGCGGCGCGGCCTCGC
CACGGCGCCATGTCGCTGGAGGGCGGGTTCCTCGGCGGCGCGCTCCCCGCCGAGGACCGG
GTGGCGCCGCGGGCATCGGCGTCGCGCCAGGCAGAGGCGGGGGCTGGGGCGGGGGCGGCG
CGTCCTCCTCCCAGGTCGATGTCGAAGATCCCCGAGAGCAGCATTGGGCTGTACGACCCC
TCCATGGAGCGCGACTCCTGCGGCGTCGGCTTCATCGCCGAGCTCTCCGGCGAGTACAGC
CGCAAAACGGTCGACGACGCCATAGAGATGCTCGATAGAATGGCTCACCGTGGCGCCTGC
GGCTGCGAGAAGAACACCGGAGATGGCGCAGGCATCCTCGTCGCTCTGCCGCACAACTTC
TTCAGAGAGGTCACGAAGGACGCAGGTTTTGAGCTTCCGCCGCCTGGTGAGTACGCCGTC
GGGATGTTTTTCATGCCCACAGATGACAAACGCCGTGAAAAGAGCAAGCTTTTGTTTCGT
GAGAAAGCAGAGTTGCTGGGGCATACCGTCCTCGGCTGGCGCCGGGTTCCCACAGACAAC
TCGGGCTTGGGTCAATCAGCGGTAGATACAGAACCAGTGATTGAGCAAGTGTTTGTCACC
AAAAGTGCAAGTTCAAAGGCTGATTTTGAGCGGCAGATGTACGTCCTACGGAGGTTCTCA
GTTATGTCCATACGAGAAGTTCTAGGCGTCAAGAATGGCGGAACAAAAGATTTCTACATG
TGCTCTCTATCTTCAAGGACCATTGTTTATAAGGGTCAGCTTAAGCCAAGCCAACTCAAG
GGGTACTTCTTTGCAGACTTAGGCGATGAAAGCTTCACAAGTTACATGGCACTGATCCAC
TCAAGATTTTCCACGAACACCTTCCCTAGTTGGGATCGAGCGCAACCAATGCGTGTTTTG
GGGCATAATGGCGAGATCAATACCCTTAGAGGGAACAAGAACTGGATGAAGGCACGTGAG
GGTCTCTTGAAGTGCGAGGGACTAGGTCTAACAAGGGATGAAATGTTGAAACTTCTGCCG
ATAGTGGATGCTACATCTTCGGATTCAGGTGCAATCGACAATGTTCTTGAGCTTCTCATA
CAATCTGGAAGAAGTGCGCCAGAGGCTGTCATGATGATGATCCCTGAGGCGTGGCAAAAC
GATGTTAACATGGACCCTGAGAGAAAAGCTTTGTATGAGTTCTTTTCAGCACTTATGGAG
CCTTGGGATGGACCAGCTCTAATCTCATTTACTGATGGCCGCTACCTTGGTGCAACCCTT
GATCGTAATGGTTTGAGGCCAGGCCGGTTTTATGTGACCTACAGTGGCCGTGTAATTATG
GCTAGTGAAGTTGGTGTGGTCGATGTTCCTCCTCAAGATGTTTCAAGAAAGGGTAGGCTA
AACCCTGGAATGATGCTTTTAGTTGATTTTGAGAACCATTGTGTTGTGAATGATGATGAA
TTGAAGAAAGAGTACTCCAAAGTTCGTCCATATGGAGAGTGGCTGAAAAGACAAAGGATA
CAACTCACAGATATCATAGAATCTGTAAATGAAGCAGAGAGAATTGCACCGAGCATTTCG
GGTGCACTTCCAATTACAAAGGAGAACAAAGCAGATATGGGTATCTGCGGAATTCTGACT
CCGCTGAAGGCTTTTGGGTATACAAGAGAAGCCCTTGAAATGCTGATGCTACCGATGGCC
AAAGATGGACAAGAAGCTCTTGGATCAATGGGAAATGATACTCCTCTAGCTGTGATGTCA
AACAGAGAGAAGCTGACTTTTGAATACTTCAAGCAGATGTTTGCACAAGTTACAAACCCA
CCGATTGACCCGATCCGGGAGAAAATTGTCACATCTATGGAGTGCATGATTGGTCCTGAA
GGTGACTTGTCTGAAACAACAGAGCGGCAGTGCCATCGCCTCACGCTTAAGAGTCCTTTA
CTGAATACAAATGAAATGGAGGCTATTAAAAAGATGAACTACCGGGGTTGGCGCAGCAAG
GTGCTTGACATAACTTATCCTAAAAAGAATGGCAGGATGGGCTTAAAACAGACTTTAGAT
AAAATTTGTGCTCAAGCACGTGAAGCTATTCATGAGGGCTACACTATTCTAGTTCTCTCT
GATAGAGGTTTTTCTTCAGAGCGTGTAGCTGTCAGTTCCCTATTGGCAGTTGGAGCTGTC
CATCAGCACCTTGTCTCACATCTTGAGAGGACACGCATAGGATTGTTAGTTGAATCTGCT
GAACCTCGCGAAGTGCACCATTTTTCCACCCTTATTGGATTTGGTGCTGATGCTATATGC
CCTTATTTAGCTATAGAAGCAATATGGCGGTTGCAAATTGATGGGAGGATTCCTCCTAAT
GATGGGAAACCTTATACACAAGAACAACTTATCGAGAAATATTTTTATGCTTCAAACTAT
GGAATGATGAAAGTTCTTGCGAAGATGGGAATATCCACTCTGGCATCTTACAAAGGTGCT
CAGATTTTTGAGGCCCTTGGTCTTGCTTCGGAAGTGGTCAGCAAGTGTTTTGAAGGTACT
CCTAGTAGAGTTGAAGGTGCAACCTTTGAAATGCTTGCACAAGATGCTCTTCGTCTCCAT
GAGATTGCATTCCCATCAAGAACTTTACCTCCTGGAAGTGCAGATGCAAATGCTCTTCCC
AACCCTGGGGATTACCATTGGAGGAAAAATGGAGAAGTACACCTTAATGATCCTTTTTCC
ATTGCAAAATTACAAGAAGCAGCACGGATTAACAGCAGGGAAGCATACAAAGAATATTCT
AGGCGCATTTACGAGCTGAATAAGGCATGTACTCTGCGTGGCATGCTGAAATTTAGAGAA
ATTCCAAACCAAATTTCCTTGGACGAGGTAGAACCTGCAAAGGAGATAGTGAAGCGGTTC
TGTACTGGAGCAATGAGTTATGGATCCATTTCCTTGGAAGCTCATACTTCCCTGGCTGAG
GCTATGAACACCCTTGGAGGAAAATCTAACACAGGTGAGGGAGGGGAACAACCTTGCCGT
ATGGTGCCTCTTCCTGATGGATCAAAGAATCCAAGAATAAGTGCAATCAAGCAAGTTGCC
AGCGGAAGATTTGGAGTTTCCATCTATTATTTGACTAATGCAGTTGAGGTGCAGATAAAA
ATGGCTCAGGGTGCTAAACCTGGTGAAGGTGGTGAGCTACCAGGCCACAAGGTCATTGGT
GATATTGCAGTCACTAGAAATTCTACAGCTGGTGTAGGGCTCATTAGCCCACCTCCTCAC
CACGATATATATTCTATTGAGGATCTCGCACAACTTATCCATGACCTTAAGAATGCAAAC
CCAGGTGCCAGAATCAGCGTCAAACTAGTCTCTGAAGCTGGTGTAGGAATTGTCGCTAGT
GGTGTGGTGAAAGGACATGCAGACCATGTTCTGATCTCTGGACATGATGGAGGCACTGGA
GCCTCCAGATGGACAGGGATTAAAAATGCTGGACTTCCTTGGGAGCTTGGATTAGCTGAA
ACACACCAGACTCTTGTGGCCAATGGTCTCCGTGGCCGAGCTGTTCTTCAGACAGATGGA
CAGATGAAAACTGGTAGAGATGTTGCTGTTGCTTGTTTACTTGGAGCAGAAGAATTTGGA
TTCAGCACAGCGCCATTAATCACACTTGGCTGCATTATGATGAGGAAGTGCCATACCAAC
ACTTGCCCTGCTGGTATTGCTACACAAGATCCAGTGCTCCGCGCAAAGTTTGCTGGGAAG
CCAGAACATGTCATAAACTACTTCTTCATGCTTGCTGAAGAGGTACGAGAAATCATGGCA
CAGCTTGGCTTCCGCACTGTTAATGAAATGGTTGGGCGATCGGACATGCTTGAGATCGAT
CCCAAAGTACTGGAGGGCAACGAGAAACTTGAAAACATTGATCTCTCACGGCTGCTGAAA
CCAGCTGCTGAAATTAGCCCTGGGGCTGTTCAATATTGTGTTGAGAAGCAAGATCATGGC
CTCGACATGGCATTAGATAACAAACTCATAGCCTCCTCAACAGCTGCCCTTCGAAAAGGT
GTTCGTGTTTTCATTGAGACACCAGTACGGAACATTAACCGAGCTGTTGGTACTATGCTC
AGCCATGAAGTCACAAAACGGTATCACATTCATGGATTGCCATCAGATACCATCCATATT
AAGCTGAATGGAAGTGCTGGCCAAAGTTTTGGTGCTTTTCTCTGTCCTGGGATCACTCTT
GAGCTTGAGGGAGACAGCAACGATTATGTTGGTAAGGGACTATCTGGTGGAAAGATTGTT
GTGTATCCACCAAGAAATAGTCGATTTAATCCACAAGACAATATTGTGATTGGTAATGTG
GCTTTATATGGTGCTACAAAGGGAGAGGCATATTTCAATGGTATGGCGGCAGAAAGGTTT
TGTGTCCGCAATTCAGGAGCTCAAGCAGTAGTTGAAGGGATTGGCGATCATGGATGTGAG
TACATGACAGGAGGTACAGCTGTTATTCTTGGAAAAACTGGTAGGAACTTTGCAGCTGGC
ATGAGTGGAGGTATTGCTTATGTTTATGATGTGGATGGGAAGTTCAGTAGCCGTTGCAAC
TATGAGCTAGTTGACTTGTATGCTGTAGTTGAAGAGGATGACATCACAACATTGAGAATG
ATGATACAACAGCACAGACTTCATACACAAAGTGATTTGGCCAGAGATATACTCTTGAAT
TTTGATACTCTCCTCCCAAAATTTATAAAAGTATATCCAAGGGattacaagcgggttttg
gataaactaaaagaagagaaggctgctaaagaagcagagcaaaaggcaagagaagtggtg
gatAAGAAGCCAGTTGAAGTAATTCAAGCTCCAAATGGCATTTCAGTAAAGACAGAGAAA
GTAATGAACGAAGAGCCATCAAGCCGACCATCACGAGTTTCAAATGCTGTAAAGTACCGA
GGTTTCATAAAATATGAGCGAGAGGGTACTTCTTACAGAGATCCAAATGAGCGTGTAAAA
GATTGGAATGAAGTTGCAATTGAATTGGTTCCTGGGCCACTGCTAAAGACGCAATCTGCT
CGGTGCATGGATTGTGGCACTCCTTTCTGTCATCAGGAGGGTTCTGGTGCTGGTTGTCCT
CTTGGAAATAAGATTCCTGAATTCAATGAATTGGTTCATCAGAATAGATGGCATGAAGCC
TTGGATCGGCTACTTGAGACAAACAATTTCCCTGAGTTTACTGGACGAGTTTGTCCTGCT
CCTTGTGAGGGTTCGTGCGTACTTGGCATTATAGACAATCCAGTATCCATAAAAAGCATA
GAGTGCGCCATCATAGACAAAGGATTTGAAGAGGGATGGATGGTACCACGGCCTCCACTT
CGGAGAACAGGAAAGAGAGTTGCTATTGTTGGCAGTGGCCCAGCTGGTCTAGCTGCTGCA
GACCAACTGAACAAAATGGGCCATTTCGTGACTGTCTTTGAACGTGCTGACCGTATTGGA
GGACTGATGATGTATGGGGTTCCAAATATGAAGGCTGACAAAGAGGGCATTGTTCAGCGA
CGTGTCGAGTTGATGGCTAAGGAGGGGGTTCAATTCATTGTGAATGCCCATGTTGGAAGT
GACCCTTTATACTCCGTTGAAAAGCTCCGCTCTGAGAATGATGCCATTATTTTGGCCTGT
GGAGCTACAAAGCCAAAAGATCTCCCTATTCCTGGACGGGAGTTGGCAGGCATCCATTTC
GCTATGGAATTTCTTCATGCCAATACCAAAAGTTTACTTGACAGCAACTTGGAGGATGGT
AACTACATATCAGCCCAAGGGAGAAAGGTGGTTGTCATTGGTGGTGGAGACACAGGCACA
GATTGCATTGGGACATCCATTAGGCATGGTTGCACCAACCTTGTAAATCTTGAACTTTTG
CCAGAGCCACCAAGAAAGAGGGCACCTGACAACCCCTGGCCCCAGTGGCCCAGGATCTTC
CGTGTTGATTATGGGCACCAGGAAGCAACTAGCAAGTTTGGAAAAGATCCAAGAAGTTAC
AAAGTCCTGACGAAGCGATTTATCGGAGATGAGAATGGAAATGTGAAGGCCCTTGAGGTA
ATACGTGTTGAATGGGGAAAGGTGAACGGAAGGTTCCAATTCAAGGAAGTTGAAGGATCA
GAAGAAATTATTGAGGCCGATCTTGTCCTCTTAGCTATGGGATTCCTGGGTCCCGAAGCG
ACTGTTGCTAACAAGCTGGGTCTAGAACAAGACATGAGGTCAAACTTCAAAGCTCAATTT
GGAAACTTTGCGACCAATGTGGAAGGTGTATTTGCTGCTGGAGACTGCAGACGTGGGCAA
TCACTGGTTGTTTGGGCCATCACAGAGGGGCGCCAAGCTGCAGCAGCCGTAGACAATTAC
CTGTCGAAGGATGATGAAGGTGAAACCAATGGCACAGAGGACATTGCTGTCTCAAGTGAA
GGTCTGGTCCAACCCGTAGTTGCATAG

Protein

2189 aa

>Os05t0555600-03 NADH-glutamate synthase, Remobilization of nitrogen in senescing organs
MSAAQGLALKLRAAPAAGGVRGEKRRRAASATAAAAARPRHGAMSLEGGFLGGALPAEDR
VAPRASASRQAEAGAGAGAARPPPRSMSKIPESSIGLYDPSMERDSCGVGFIAELSGEYS
RKTVDDAIEMLDRMAHRGACGCEKNTGDGAGILVALPHNFFREVTKDAGFELPPPGEYAV
GMFFMPTDDKRREKSKLLFREKAELLGHTVLGWRRVPTDNSGLGQSAVDTEPVIEQVFVT
KSASSKADFERQMYVLRRFSVMSIREVLGVKNGGTKDFYMCSLSSRTIVYKGQLKPSQLK
GYFFADLGDESFTSYMALIHSRFSTNTFPSWDRAQPMRVLGHNGEINTLRGNKNWMKARE
GLLKCEGLGLTRDEMLKLLPIVDATSSDSGAIDNVLELLIQSGRSAPEAVMMMIPEAWQN
DVNMDPERKALYEFFSALMEPWDGPALISFTDGRYLGATLDRNGLRPGRFYVTYSGRVIM
ASEVGVVDVPPQDVSRKGRLNPGMMLLVDFENHCVVNDDELKKEYSKVRPYGEWLKRQRI
QLTDIIESVNEAERIAPSISGALPITKENKADMGICGILTPLKAFGYTREALEMLMLPMA
KDGQEALGSMGNDTPLAVMSNREKLTFEYFKQMFAQVTNPPIDPIREKIVTSMECMIGPE
GDLSETTERQCHRLTLKSPLLNTNEMEAIKKMNYRGWRSKVLDITYPKKNGRMGLKQTLD
KICAQAREAIHEGYTILVLSDRGFSSERVAVSSLLAVGAVHQHLVSHLERTRIGLLVESA
EPREVHHFSTLIGFGADAICPYLAIEAIWRLQIDGRIPPNDGKPYTQEQLIEKYFYASNY
GMMKVLAKMGISTLASYKGAQIFEALGLASEVVSKCFEGTPSRVEGATFEMLAQDALRLH
EIAFPSRTLPPGSADANALPNPGDYHWRKNGEVHLNDPFSIAKLQEAARINSREAYKEYS
RRIYELNKACTLRGMLKFREIPNQISLDEVEPAKEIVKRFCTGAMSYGSISLEAHTSLAE
AMNTLGGKSNTGEGGEQPCRMVPLPDGSKNPRISAIKQVASGRFGVSIYYLTNAVEVQIK
MAQGAKPGEGGELPGHKVIGDIAVTRNSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNAN
PGARISVKLVSEAGVGIVASGVVKGHADHVLISGHDGGTGASRWTGIKNAGLPWELGLAE
THQTLVANGLRGRAVLQTDGQMKTGRDVAVACLLGAEEFGFSTAPLITLGCIMMRKCHTN
TCPAGIATQDPVLRAKFAGKPEHVINYFFMLAEEVREIMAQLGFRTVNEMVGRSDMLEID
PKVLEGNEKLENIDLSRLLKPAAEISPGAVQYCVEKQDHGLDMALDNKLIASSTAALRKG
VRVFIETPVRNINRAVGTMLSHEVTKRYHIHGLPSDTIHIKLNGSAGQSFGAFLCPGITL
ELEGDSNDYVGKGLSGGKIVVYPPRNSRFNPQDNIVIGNVALYGATKGEAYFNGMAAERF
CVRNSGAQAVVEGIGDHGCEYMTGGTAVILGKTGRNFAAGMSGGIAYVYDVDGKFSSRCN
YELVDLYAVVEEDDITTLRMMIQQHRLHTQSDLARDILLNFDTLLPKFIKVYPRDYKRVL
DKLKEEKAAKEAEQKAREVVDKKPVEVIQAPNGISVKTEKVMNEEPSSRPSRVSNAVKYR
GFIKYEREGTSYRDPNERVKDWNEVAIELVPGPLLKTQSARCMDCGTPFCHQEGSGAGCP
LGNKIPEFNELVHQNRWHEALDRLLETNNFPEFTGRVCPAPCEGSCVLGIIDNPVSIKSI
ECAIIDKGFEEGWMVPRPPLRRTGKRVAIVGSGPAGLAAADQLNKMGHFVTVFERADRIG
GLMMYGVPNMKADKEGIVQRRVELMAKEGVQFIVNAHVGSDPLYSVEKLRSENDAIILAC
GATKPKDLPIPGRELAGIHFAMEFLHANTKSLLDSNLEDGNYISAQGRKVVVIGGGDTGT
DCIGTSIRHGCTNLVNLELLPEPPRKRAPDNPWPQWPRIFRVDYGHQEATSKFGKDPRSY
KVLTKRFIGDENGNVKALEVIRVEWGKVNGRFQFKEVEGSEEIIEADLVLLAMGFLGPEA
TVANKLGLEQDMRSNFKAQFGNFATNVEGVFAAGDCRRGQSLVVWAITEGRQAAAAVDNY
LSKDDEGETNGTEDIAVSSEGLVQPVVA*

5'UTR

chr05:27622654..27622688 (+ strand) : 35 bp

CDS

chr05:27622689..27623057 (+ strand) : 369 bp

chr05:27623172..27623291 (+ strand) : 120 bp

chr05:27623394..27623507 (+ strand) : 114 bp

chr05:27623621..27623773 (+ strand) : 153 bp

chr05:27623868..27623968 (+ strand) : 101 bp

chr05:27624269..27624365 (+ strand) : 97 bp

chr05:27624866..27624975 (+ strand) : 110 bp

chr05:27625099..27625202 (+ strand) : 104 bp

chr05:27625453..27625632 (+ strand) : 180 bp

chr05:27625722..27626065 (+ strand) : 344 bp

chr05:27626165..27626229 (+ strand) : 65 bp

chr05:27626305..27626774 (+ strand) : 470 bp

chr05:27627251..27628117 (+ strand) : 867 bp

chr05:27629340..27629494 (+ strand) : 155 bp

chr05:27629619..27629780 (+ strand) : 162 bp

chr05:27629989..27631554 (+ strand) : 1566 bp

chr05:27631708..27631926 (+ strand) : 219 bp

chr05:27634248..27634522 (+ strand) : 275 bp

chr05:27634615..27634920 (+ strand) : 306 bp

chr05:27635069..27635336 (+ strand) : 268 bp

chr05:27635486..27635740 (+ strand) : 255 bp

chr05:27635861..27636127 (+ strand) : 267 bp

3'UTR

chr05:27636128..27636191 (+ strand) : 64 bp

FASTA

>Os05t0555600-03 class=Sequence position=chr05:27622654..27636191 (+ strand)
TACTAGTAGC GGAGGCATTC GTTCCCGCGC GGGCAATGTC GGCGGCGCAG GGCCTTGCGC TGAAGCTGCG CGCCGCGCCG
GCGGCGGGTG GCGTCCGCGG GGAGAAGCGG CGCCGCGCGG CATCGGCGAC CGCGGCGGCG GCGGCGCGGC CTCGCCACGG
CGCCATGTCG CTGGAGGGCG GGTTCCTCGG CGGCGCGCTC CCCGCCGAGG ACCGGGTGGC GCCGCGGGCA TCGGCGTCGC
GCCAGGCAGA GGCGGGGGCT GGGGCGGGGG CGGCGCGTCC TCCTCCCAGG TCGATGTCGA AGATCCCCGA GAGCAGCATT
GGGCTGTACG ACCCCTCCAT GGAGCGCGAC TCCTGCGGCG TCGGCTTCAT CGCCGAGCTC TCCGGCGAGT ACAGCCGCAA
AACGGTGAGG TTTCCGCGGC TAAGCACGGC GCTGGAGTTG ATTGTTCCCG TGCAAACAAT CGAAACCCCC AACGCGGCGT
GAATTTCTGA TATTCTGAAA TTGTTCTCGG TTTTGCAGGT CGACGACGCC ATAGAGATGC TCGATAGAAT GGCTCACCGT
GGCGCCTGCG GCTGCGAGAA GAACACCGGA GATGGCGCAG GCATCCTCGT CGCTCTGCCG CACAACTTCT TCAGAGAGGC
AAACCTACTT GAAGTTTTAA GCCGAGAAAT ATGGGAATTT TCTACCGCTG GGGGAATCAT TTTTTTTTCT GCCTGTTTTT
GTTTTTTTGT GTTCTGACAG GTCACGAAGG ACGCAGGTTT TGAGCTTCCG CCGCCTGGTG AGTACGCCGT CGGGATGTTT
TTCATGCCCA CAGATGACAA ACGCCGTGAA AAGAGCAAGC TTTTGTTTCG TGAGGTTGGT GACCAAGCAG AACACTAGAA
CAGTTCAGTT CAATCCTATT GTAACTGATA TCATGATACC ATTCTCAATT TCGTGTTGTA TCTTTGGATT TGTTTGGGTT
CATGCAGAAA GCAGAGTTGC TGGGGCATAC CGTCCTCGGC TGGCGCCGGG TTCCCACAGA CAACTCGGGC TTGGGTCAAT
CAGCGGTAGA TACAGAACCA GTGATTGAGC AAGTGTTTGT CACCAAAAGT GCAAGTTCAA AGGCTGATTT TGAGCGGCAG
GTTATTTGAT GAGCCAGCAC ATTTGAACTT TATGGATTTC ATCCGTAGCT GTTAATTTTT CCTTGACTTG TTCTTTTGTT
GACTGCAACT CCAGATGTAC GTCCTACGGA GGTTCTCAGT TATGTCCATA CGAGAAGTTC TAGGCGTCAA GAATGGCGGA
ACAAAAGATT TCTACATGTG CTCTCTATCT TCAAGGTTCT GTGTTACCAT CCCATTAAAG AATGTGGTTT AAGTTTCCAA
CCTTGGGTAA TTTGAAGCGC TAGCCACTAA GGATTTCAGT TATCTGTATT AAGCAACAGT AAGCTGTGAT ATGGAATAAA
AAAAAACATG TTTCAGAAAT GCTTCATTTT GATAACAAGG AATAGAAGAA AACTTTTGGA TGTTTTTTTT TCCTTTGTGA
TTTGATCTCA TCTGAAGTGA AGTTTGATTT GGTCACATGT GCATGCATTC CATTTTCTGC CAAGTAATTA TTTCCTGAAA
TTCGGTTTTT TACAGGACCA TTGTTTATAA GGGTCAGCTT AAGCCAAGCC AACTCAAGGG GTACTTCTTT GCAGACTTAG
GCGATGAAAG CTTCACAAGT TACATGGCAC TGGTAAGTGA ATAACCATTT CAATATTGTC TGAACAACAA AATCCATGAT
CATAGTCAGA AGATAGGATT ACTAGCAGCA AGATTTTTGT GAGGATATAT AATGCTTCTA AGCAGGCATC AAATATCCTC
TTTTCTTTTA TTAATATTAA TATGCTATTT CCCTCCTGTT TCGTGATGCC TTTGGCTGAA GCTGTAGAAA CTGAAACTGT
GTCAGCTGAT GCCCAACAAA AAAGACACTT CAGAATCCTT GTGTAGTTCT GCTATTAGGT ACTGCTTTTT CAGAATGTGT
ATCCTAATTA GGTGGTTTGA ACAAACTTTA TTTGGCTTGA GGTAGCTTAG GTTCTGAAAC TGTTTTACAT GGATGATAGC
ATATGGAGCA GGATTCAAGG ATAGATAGTA CTGGCCTACT GGGTATTCAT ATGAAACCAT ATTGCATATC ATTTATATGT
AGTTGTGCAA AAGATGAACA AGGTATAGTT TAAAAGTTAT GCATGCAAAC AGATCCACTC AAGATTTTCC ACGAACACCT
TCCCTAGTTG GGATCGAGCG CAACCAATGC GTGTTTTGGG GCATAATGGC GAGATCAATA CCCTTAGAGG GAACAAGAAC
TGGTAATTTC ACTAAACACA TCTCTCATCA TTTTCTTGTG AGCAAGAATC TTCACATGCC TATGGACCAT GGAGCTTATA
TTTATATGCT TACTTGCACT TTTGTCCTAT TTCCATGTTT GGTAGGATGA AGGCACGTGA GGGTCTCTTG AAGTGCGAGG
GACTAGGTCT AACAAGGGAT GAAATGTTGA AACTTCTGCC GATAGTGGAT GCTACATCTT CGGATTCAGG TTCCATTCCT
TTATCATAAT TTACACATGA TAAAAATAAA AGCAGTAGTT TGCTGCTAGC TCTGTCTCTG AAACAATGTG TGTGTGTGTG
TGTATGTATA CATATATATA TTGGGAATAC GTGAGACGCA CATTTTTGTA TTAAGAGAAA TAAATGTGTA TATTTGGGAT
TCCATATCCC TTTTCACCTG TCAAATGGAA GTATGGCCAT CTTTGCAAAG TTATTTATTG AATTATCTTG TGAATTCAGG
TGCAATCGAC AATGTTCTTG AGCTTCTCAT ACAATCTGGA AGAAGTGCGC CAGAGGCTGT CATGATGATG ATCCCTGAGG
CGTGGCAAAA CGATGTTAAC ATGGACCCTG AGAGAAAAGC TTTGTATGAG TTCTTTTCAG CACTTATGGA GCCTTGGGAT
GGACCAGCTC TAATCTCATG TAACAAGATA AAACTAAACT CTCTTCTTAA TATTGATGCA TGCATTATGA TAGATAAGTA
TCAATTCTGA CCTGGTCTTC ACGCACAGTT ACTGATGGCC GCTACCTTGG TGCAACCCTT GATCGTAATG GTTTGAGGCC
AGGCCGGTTT TATGTGACCT ACAGTGGCCG TGTAATTATG GCTAGTGAAG TTGGTGTGGT CGATGTTCCT CCTCAAGATG
TTTCAAGAAA GGGTAGGCTA AACCCTGGAA TGATGCTTTT AGTTGATTTT GAGAACCATT GTGTTGTGAA TGATGATGAA
TTGAAGAAAG AGTACTCCAA AGTTCGTCCA TATGGAGAGT GGCTGAAAAG ACAAAGGATA CAACTCACAG ATATCATAGA
ATCTGTAAAT GAAGCAGAGA GAATTGCACC GAGCATTTCG GGTGCACTTC CAGTAAGTTA ATTATCTTGC TAACTTTTGG
AGTGTCCTGT TGGTTAGTAA TTTACCATGT AATGGTGAGG TATTTTATGG ATTTTTCACA CTTTGCTGCA GATTACAAAG
GAGAACAAAG CAGATATGGG TATCTGCGGA ATTCTGACTC CGCTGAAGGC TTTTGGGTAA GCAACAGCCC AATCTTAGTA
TGTTTCTTCT CATCCTCCTT GTTGAAAAAT TACCTATTTG GTTGGATTCA GGTATACAAG AGAAGCCCTT GAAATGCTGA
TGCTACCGAT GGCCAAAGAT GGACAAGAAG CTCTTGGATC AATGGGAAAT GATACTCCTC TAGCTGTGAT GTCAAACAGA
GAGAAGCTGA CTTTTGAATA CTTCAAGCAG ATGTTTGCAC AAGTTACAAA CCCACCGATT GACCCGATCC GGGAGAAAAT
TGTCACATCT ATGGAGTGCA TGATTGGTCC TGAAGGTGAC TTGTCTGAAA CAACAGAGCG GCAGTGCCAT CGCCTCACGC
TTAAGAGTCC TTTACTGAAT ACAAATGAAA TGGAGGCTAT TAAAAAGATG AACTACCGGG GTTGGCGCAG CAAGGTGCTT
GACATAACTT ATCCTAAAAA GAATGGCAGG ATGGGCTTAA AACAGACTTT AGATAAAATT TGTGCTCAAG CACGTGAAGC
TATTCATGAG GGCTACACTA TTCTAGTTCT CTCTGATAGA GGTCAGTAAG ATTCAGTTAC ACCAGACTCA CTAAGCATGA
ATTTTATGAT CCATGAATTT ATCATCATCT AGATATAGAT TCATGAGCAA TAGTGTTAGT ATGAAATCAA TATTCTCCCC
AAAATCTTTA CTTTTGAGCT GAATTCAATA TTGTGTTATT GTGGTATGAA AGATATCAAG ATTTTTTTCT ATACAGATCA
TGAATAAGTA TATTTTCGTA ACAACATGTT AACAGTCAAC ATCTTAGTTT CATCTTAGGT TAGGTCGTAC TTAGTTTTTC
TTGCTCCTCT TGGATCATGT GTCAACATAG CTCAGCTTTT CTTCTTTTTT TTTTTTTTGC ATCCAAGCTC AGCTTTCCCA
AGCTTGTCAC CATGATATGT GCTCTGCATT TCAATGTTTA ATTCTCAAAA TTAACTTGAT CCGTCATCTG TAGCATTTGG
ATTAAAACAT TTGCTTTAAC TAGAAGTTTC CATACAGGTT TTTCTTCAGA GCGTGTAGCT GTCAGTTCCC TATTGGCAGT
TGGAGCTGTC CATCAGCACC TTGTCTCACA TCTTGAGAGG ACACGCATAG GATTGTTAGT TGAATCTGCT GAACCTCGCG
AAGTGCACCA TTTTTCCACC CTTATTGGAT TTGGTGCTGA TGCTATATGC CCTTATTTAG CTATAGAAGC AATATGGCGG
TTGCAAATTG ATGGGAGGAT TCCTCCTAAT GATGGGAAAC CTTATACACA AGAACAACTT ATCGAGAAAT ATTTTTATGC
TTCAAACTAT GGAATGATGA AAGTTCTTGC GAAGATGGGA ATATCCACTC TGGCATCTTA CAAAGGTGCT CAGATTTTTG
AGGCCCTTGG TCTTGCTTCG GAAGTGGTCA GCAAGTGTTT TGAAGGTACT CCTAGTAGAG TTGAAGGTGC AACCTTTGAA
ATGCTTGCAC AAGATGCTCT TCGTCTCCAT GAGATTGCAT TCCCATCAAG AACTTTACCT CCTGGAAGTG CAGATGCAAA
TGCTCTTCCC AACCCTGGGG ATTACCATTG GAGGAAAAAT GGAGAAGTAC ACCTTAATGA TCCTTTTTCC ATTGCAAAAT
TACAAGAAGC AGCACGGATT AACAGCAGGG AAGCATACAA AGAATATTCT AGGCGCATTT ACGAGCTGAA TAAGGCATGT
ACTCTGCGTG GCATGCTGAA ATTTAGAGAA ATTCCAAACC AAATTTCCTT GGACGAGGTA GAACCTGCAA AGGAGATAGT
GAAGCGGTTC TGTACTGGAG CAATGAGTTA TGGATCCATT TCCTTGGAAG CTCATACTTC CCTGGCTGAG GCTATGAACA
CCCTTGGAGG AAAATCTAAC ACAGGTATCT CGCATCATAT ACGGACCTGA ACTTTTGCTG AGTCAGTTAC TTTAAATGTC
ATGTGTGCTT TGTGTTGCAT GTTTGCTTGA TATAGTTCTA AGCTTCTTGA TTTCCCATGA TAACTTGCAA AAACTTTGAG
CTAAAAAGTA ACATCTAAAA ACTAGTTGGC TCTTTTAGAT CCTTTTAACA TTGTTATTCC CAAATCACTT GAATTATGCT
TAAAGTTCTT AATTATATGT GCCTGGAACG TGAAGGTTAT ATAACTATTA AGAATGGGAG CAAAGGCCAG TTAACAACTC
AAACACTGAC CTTCTTCCGT GGCACAGGTT AAGCTTTATA GTAGCCAAAT TACCCTTGAT ATTGGAAATA GAAGTATAAT
ATCCCCCCAT TAGTTGCCAG ACCAATTTTT GACGGTGTCG ATTGAACTGC GTATCATTAC ATAGTGGGAG GGTAACCACA
TAAGCGTAGA GTTGTAACAC CATATGACCC AAAATTCGCC CAATGGCTGG GCCTCCATTT GGTGGTGGGG GATGGGCCAC
TCTTGCATAG CACCTTACTT GGGCTTTCAT CCTTGCTTTC CCAGAAAGGT TAACAAGATC AGGAAATGTT ATATTTTGGG
CCAACAGGGC TTATACGCTA CTATAGCTAA AGGTAAACAG GCAATTGGTT TTTTTACCTT TCCAGTCGAA CCATTTGCTT
TGGGTAGATG GTGTTGTGAG AACTTTGTTC CTTTCAATCT TAATACAAAT GATGCACAAA GCTTATGCGC ATTCCCTAAG
AAAAACGTAA GTGAATAAAT CAGGGGATCC TTTGACAGGC GTATAAGGCT TTCTTTTTTG TTAATTGATA GTAGGCATAT
ATCACTTGGA TTCAATCCAG TAGCTTAGAT CATAGTCTTT GTTTGTTCTC CGATTTCAGG GCTAGTCGCA ATTTGATATG
AACCTTTATT TTAAATTCCT TCTGAACTAT TTTCATATGC TACACAGAAA CAAATGGGAA GATGCCTGTT GTTTGCTTAT
TTGAGCACAG CAGCTAGGCT GATGCAAGTT ATTTATCAAC TTTTGTTCAT TCTTCTCTAA TATTGCACTT CCTATCTGCA
GAGCATCTTA TGTAAACCTT TTTATGACTT ATTTGTGCAC AGCTATTTAT TTAGAATATC AACTTACTAC TGTAGTGAAT
TTGCTAACTG ACTCCATTTT ATATGTTAAT TGGGACATCT AAAAAGGTGA GGGAGGGGAA CAACCTTGCC GTATGGTGCC
TCTTCCTGAT GGATCAAAGA ATCCAAGAAT AAGTGCAATC AAGCAAGTTG CCAGCGGAAG ATTTGGAGTT TCCATCTATT
ATTTGACTAA TGCAGTTGAG GTGCAGATAA AAATGGCTCA GGTATTTGAC CAGATTGGTT TTTTGTAAAA CTAAACGAGT
TACTTCCTGC AATATGTCCA TGACCACTGG TCTGGCTATT TCATCAGGCA GTAGAAATTT ATGTCTTGTT CCTCTAACTG
TATAGGGTGC TAAACCTGGT GAAGGTGGTG AGCTACCAGG CCACAAGGTC ATTGGTGATA TTGCAGTCAC TAGAAATTCT
ACAGCTGGTG TAGGGCTCAT TAGCCCACCT CCTCACCACG ATATATATTC TATTGAGGAT CTCGCACAAC TTATCCATGA
CCTTAAGGTA TAGTCTCATT TGTAAAAAGT CTCATGATGG TGGCTTATAA CTATTTAGTG CAAGACTCCA GTTTGCCACT
TACACATTTA CTTCCTTATT AATTGGCATT TTTTTGTTGT AATGTTTCAT ATTAGAGAAC CTTTTTAATT GAAATCATGC
ATGTTGCACT TTACAGTTTT GCTTGCTTAT GCTATATCGC TTCTTTCTAC TGTAGAATGC AAACCCAGGT GCCAGAATCA
GCGTCAAACT AGTCTCTGAA GCTGGTGTAG GAATTGTCGC TAGTGGTGTG GTGAAAGGAC ATGCAGACCA TGTTCTGATC
TCTGGACATG ATGGAGGCAC TGGAGCCTCC AGATGGACAG GGATTAAAAA TGCTGGACTT CCTTGGGAGC TTGGATTAGC
TGAAACACAC CAGACTCTTG TGGCCAATGG TCTCCGTGGC CGAGCTGTTC TTCAGACAGA TGGACAGATG AAAACTGGTA
GAGATGTTGC TGTTGCTTGT TTACTTGGAG CAGAAGAATT TGGATTCAGC ACAGCGCCAT TAATCACACT TGGCTGCATT
ATGATGAGGA AGTGCCATAC CAACACTTGC CCTGCTGGTA TTGCTACACA AGATCCAGTG CTCCGCGCAA AGTTTGCTGG
GAAGCCAGAA CATGTCATAA ACTACTTCTT CATGCTTGCT GAAGAGGTAC GAGAAATCAT GGCACAGCTT GGCTTCCGCA
CTGTTAATGA AATGGTTGGG CGATCGGACA TGCTTGAGAT CGATCCCAAA GTACTGGAGG GCAACGAGAA ACTTGAAAAC
ATTGATCTCT CACGGCTGCT GAAACCAGCT GCTGAAATTA GCCCTGGGGC TGTTCAATAT TGTGTTGAGA AGCAAGATCA
TGGCCTCGAC ATGGCATTAG ATAACAAACT CATAGCCTCC TCAACAGCTG CCCTTCGAAA AGGTGTTCGT GTTTTCATTG
AGACACCAGT ACGGAACATT AACCGAGCTG TTGGTACTAT GCTCAGCCAT GAAGTCACAA AACGGTATCA CATTCATGGA
TTGCCATCAG ATACCATCCA TATTAAGCTG AATGGAAGTG CTGGCCAAAG TTTTGGTGCT TTTCTCTGTC CTGGGATCAC
TCTTGAGCTT GAGGGAGACA GCAACGATTA TGTTGGTAAG GGACTATCTG GTGGAAAGAT TGTTGTGTAT CCACCAAGAA
ATAGTCGATT TAATCCACAA GACAATATTG TGATTGGTAA TGTGGCTTTA TATGGTGCTA CAAAGGGAGA GGCATATTTC
AATGGTATGG CGGCAGAAAG GTTTTGTGTC CGCAATTCAG GAGCTCAAGC AGTAGTTGAA GGGATTGGCG ATCATGGATG
TGAGTACATG ACAGGAGGTA CAGCTGTTAT TCTTGGAAAA ACTGGTAGGA ACTTTGCAGC TGGCATGAGT GGAGGTATTG
CTTATGTTTA TGATGTGGAT GGGAAGTTCA GTAGCCGTTG CAACTATGAG CTAGTTGACT TGTATGCTGT AGTTGAAGAG
GATGACATCA CAACATTGAG AATGATGATA CAACAGCACA GACTTCATAC ACAAAGTGAT TTGGCCAGAG ATATACTCTT
GAATTTTGAT ACTCTCCTCC CAAAATTTAT AAAAGTATAT CCAAGGGatt acaagcgggt tttggataaa ctaaaagaag
agaaggctgc taaagaagca gagcaaaagg caagagaagt ggtggatAAG AAGCCAGTTG AAGTAATTCA AGCTCCAAAT
GGCATTTCAG TAAAGACAGA GGTAAATAAG GTTTAAGCAG GATTATTTCT CATTCTCTAT ATCGGTGATA TTTAACTTGA
CTGTTGGAAA TTTATGATGT CCTTCTTAAA ATAGTTATTA TTGTAATTCT GTAAGCTAAG CTTTCTAGTC TGACTTAAAG
TCTTTGATAT GCAGAAAGTA ATGAACGAAG AGCCATCAAG CCGACCATCA CGAGTTTCAA ATGCTGTAAA GTACCGAGGT
TTCATAAAAT ATGAGCGAGA GGGTACTTCT TACAGAGATC CAAATGAGCG TGTAAAAGAT TGGAATGAAG TTGCAATTGA
ATTGGTTCCT GGGCCACTGC TAAAGACGCA ATCTGCTCGG TGCATGGATT GTGGCACTCC TTTCTGTCAT CAGGTGATAC
TCAGTTTTTT TCCCTTTTGT ATTAAGCAGT TTTTTTTCAT AAAATACAAT GATGCTTTTC AGTACAGTAG TTTTATATGA
ATGTCACCCG GCAAAAAAGT TTTATATGAA TGTCCTTGAT GCTCTTGATT TCTTGTCCAT ATATATTAGT GCATATAGTC
GTGCATTCGC ACGAATTTAA CCATCCTCTA TACTGAATAT CTTTACATAT TATTTGTAGT AACAAAATAT ACTTCCCttt
ttaatagatg acactgttaa cttttaacat aatatttaat cattcatctt attaaaaaat attatgtaaa tgttaatttt
tttggtctga cttgttttat cattACTGCG TTATGATATT TTGGTAAGTT GGCAATGGTA GGGTATGCTT AGTTAGTTAC
CCTATAAAAT TTGGTATTTT TTTCTATTTT ATTTAATTTT TAGGTAAACT AAATTCATAA TATTTTACTT TACTTTAGAA
AGTGTGTTCG TTGAAAAAAA AACTGAGATG GTTAATTTGT GTGCTAAACA AAACCGACAA TCGAGTGTAC TTTATGCAAT
GTTTAAAAAA GTGTGTAAAG AATATAATCT ATctattata ttattaaagg aatagaaaaa gaagcctcca cgttcgctct
catggcctag aaattctcac attaatcgga gaaaaagaaa agacagagtc catatagaaa tacaatttag aaatagctga
aatttggaat taaaaaataa ggaatattag aagaggagac tagagtccat atagaaatac aatttagaaa tagttgaaat
tcggaattaa aaaataagga atattagaag aggagactag agtccatata gaaatacaat taggaaataa ctgaaattcg
gaattaaaaa gaaggaatat tcgaagtaga gtatagagtc catatagaaa tacaattagg aaataactca aattcggaat
taaaaaataa ggaatattag aaaaggagac tagagtccat atagaaatat aatttaaaat tagttgaaat tcggaattaa
aaaataagga atattagaag aggagactag agtccatata gaaatacaat taggaaataa ctgatattcg gaattaaaaa
taaggaatat tagaagtaga gtatagagtc catatagaaa tacaattaga aaataataga aaatcggaat taaaaataat
gaatattaga agtagagtat atagtccata tagaaataca attaagaaaa aaaataaatt cggaattaaa aaataaggaa
tattagaagt agagtataga gtccatatag gaatttaaaa ctaactaaaa ttcagaataa acataataaa attaaaagta
gagtttagag tctgtataaa aatacaattt acaaataact aaaattcgag attaagaaaa acatggaaag aagagtttaa
agtcaatata ggaatacaat ttagaagtaa ctgaaattcg aaattaaaaa ttaaagaata ttgaaagata agtttagagt
ccacatagaa atacaattag aaataataaa aattcagaaa taaaaataaa taatattgga agaagagcct agagtctata
tagaaataca atttacagaa aatttggaat taaaaaaata tattaaaaga tgagtctaga gtccatatag gaatatatat
attttacaaa taactaaaat ttgatattaa aaataattaa taactaacac gtatataaaa tacaatatga atattacaca
ttagtagttt cgtaaagtta ttgcaaaatc taaaattatg ttgtcatttt aatatatttg gataatatat tgagaaaaca
tatatgctat tatatgagag aaaatataat gatgctagcc gcgcaatctg cgcgggacac catgctagtt tcaatagtaa
aaCTCAAAAC TTTCAAGGTT CTTCACGTAT ACGAGGTTTT AATTGTACAC AAGGTATAAA AATAATTTAC CAATATTCAA
AACTCAAAAC CTCCAAAATT ATACGCCTAA GAAAAAAATA TTTTTTAGGC TTAAAAATAA AAAGGTGCCA TGGTTGTGAC
ATATTGGCAG GTTCAGAGGT GGACTTGGAA TATCTAGTAA CTTCCTTGCC ACTCTTCCAT CGGACAGCTG AGATTTATTC
TTCAGTTTTT GTCCTTTTAT CGATTCTATG GCCATTATTT ACTACATGAT GTGGCTTTTT CTCTTTGCAT CATCAGATTG
TCTTTTCACT TGTTAAGATT TGTGAAATTT TCTTGGTATG GTTCCTGTAT TTTTCTTATA TCAAACTTTT GCAGGAGGGT
TCTGGTGCTG GTTGTCCTCT TGGAAATAAG ATTCCTGAAT TCAATGAATT GGTTCATCAG AATAGATGGC ATGAAGCCTT
GGATCGGCTA CTTGAGACAA ACAATTTCCC TGAGTTTACT GGACGAGTTT GTCCTGCTCC TTGTGAGGGT TCGTGCGTAC
TTGGCATTAT AGACAATCCA GTATCCATAA AAAGCATAGA GTGCGCCATC ATAGACAAAG GATTTGAAGA GGGATGGATG
GTACCACGGC CTCCACTTCG GAGAACAGGG TGTGTGTTCG GCACAACTTT GTACTTGCTT TCTTATATGA GTTGAAGCAT
GTAACAATAG CTGCACCTAA AGCTACTTCA TTTTTTTGCA GAAAGAGAGT TGCTATTGTT GGCAGTGGCC CAGCTGGTCT
AGCTGCTGCA GACCAACTGA ACAAAATGGG CCATTTCGTG ACTGTCTTTG AACGTGCTGA CCGTATTGGA GGACTGATGA
TGTATGGGGT TCCAAATATG AAGGCTGACA AAGAGGGCAT TGTTCAGCGA CGTGTCGAGT TGATGGCTAA GGAGGGGGTT
CAATTCATTG TGAATGCCCA TGTTGGAAGT GACCCTTTAT ACTCCGTTGA AAAGCTCCGC TCTGAGAATG ATGCCATTAT
TTTGGCCTGT GGAGCTACAA AGCCAAAGTG AGTTAATACA AAAACGAAAA AAAGAAGAGT TTGTAACTCT AGTTTACATC
TTTCTTGGCA CCAGTTTTTA AAGTCTAAGC AACACAGTCT ATATCATTCA TGCCTTTGAA ACTTGGCTAA TGTTTAGAGC
ATTATCCTTG AGCAGAGATC TCCCTATTCC TGGACGGGAG TTGGCAGGCA TCCATTTCGC TATGGAATTT CTTCATGCCA
ATACCAAAAG TTTACTTGAC AGCAACTTGG AGGATGGTAA CTACATATCA GCCCAAGGGA GAAAGGTGGT TGTCATTGGT
GGTGGAGACA CAGGCACAGA TTGCATTGGG ACATCCATTA GGCATGGTTG CACCAACCTT GTAAATCTTG AACTTTTGCC
AGAGCCACCA AGAAAGAGGG CACCTGACAA CCCCTGGCCC CAGGTTAGTT CCCTCATCAT ATAAAACAAC AGCATCTTTA
TATTCTTTTT TTAGTGAAAA TCTTTGTATG TTTAGAATGT AAGCATTGCG CCACTACGGT TGCCTGAAAT TCCACTAACA
TTACTCTGTT GTGTTTCTAC TATTGCCTTC AGTGGCCCAG GATCTTCCGT GTTGATTATG GGCACCAGGA AGCAACTAGC
AAGTTTGGAA AAGATCCAAG AAGTTACAAA GTCCTGACGA AGCGATTTAT CGGAGATGAG AATGGAAATG TGAAGGCCCT
TGAGGTAATA CGTGTTGAAT GGGGAAAGGT GAACGGAAGG TTCCAATTCA AGGAAGTTGA AGGATCAGAA GAAATTATTG
AGGCCGATCT TGTCCTCTTA GCTATGGGAT TCCTGGGTCC CGAAGCGGTT AGTTTTCCTC CCTTTCTCTT ATGAGTTATG
ACAAGAATAG CATTACACAA TTGTGCACAT AGCTATCTGT TTAGAGACCA ACCAACACAT AGTGCCTAAC TGCATATCCT
TCTACAGACT GTTGCTAACA AGCTGGGTCT AGAACAAGAC ATGAGGTCAA ACTTCAAAGC TCAATTTGGA AACTTTGCGA
CCAATGTGGA AGGTGTATTT GCTGCTGGAG ACTGCAGACG TGGGCAATCA CTGGTTGTTT GGGCCATCAC AGAGGGGCGC
CAAGCTGCAG CAGCCGTAGA CAATTACCTG TCGAAGGATG ATGAAGGTGA AACCAATGGC ACAGAGGACA TTGCTGTCTC
AAGTGAAGGT CTGGTCCAAC CCGTAGTTGC ATAGGCCGAG AGAACATTTC TGCAATTTTG ATACAGCATT GATGATGCGA
AGATAGTAGG GCCATGCA

Locus: Os05g0555600

Loading...

Locus: Os05g0555600

Loading...