Os05t0557600-01

Locus

Os05g0557600

Description

Ubiquitin-conjugating enzyme/RWD-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC41

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 41

Oryzabase Gene Symbol Synonym(s)

OsUBC41

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 41

Transcript Evidence

AK121717 (DDBJ, Best hit)

Protein Evidence

Q5RLI8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Full-length cDNA

J033079L01 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0557600-01)

RiceXPro (AK121717)

Others

Oryzabase (19574)

KEGG (Os05t0557600-01)

Transcript

2004 bp

>Os05t0557600-01 Ubiquitin-conjugating enzyme/RWD-like domain containing protein.
ACCCAAACCCTCCCTTTCCTCCCCCAATTCTCCATTTCTCCTAGCTCGCCGGAAACCCTA
AGCGGGCCACCTCGCGCCGCGGCGGGCCGGCGAGCGATCGCATTGGGCGGCGGCGGCGAT
GGCGACCCACGCCCCCAAGGGCTACCTCTGCGCGGGGAGCTCGTCGTTCGATGATCCCGA
CGTGGTCGAGGTGACGCCGGCGGCGGCCGCGGCAGGGGGGTGGAGCTCCGGCCACCAGAA
GCGGAAGCGGAGTCAGGTTGTTCCTCATGAAGTAATTGAACTGGATGCTGATGATGATCC
TGATGGAGTTGTGATTATTGGTGAAAAATCATCAGTTGATAAGAATAAGCAAGCTGTTGG
ATATCCTATAGACTGGCTAAAGCATGCAAAGAGTAGTTTGGCTGGTGAAATTGCTGGCCC
AAGTTCCTACCCATCAAAAAATCCTGATATATTACTTGGTGGCCTGAAAATATTTCAAGA
GAACCCATTTTACAACAACATTGATGACTATGCTTATGAGGCATTTGAAGAAGATTATGG
TTATGATGAAGATGAGTATGATGATTACGATTATGATAGTACACTTTATGAAAGTGAATA
TAACTTCACTTTGGCTTCCAAGTTTGATGGTTTGGATATCCCACCTGGTGTGGAGGCTCC
TTTACCATGGTTGCAGACGACTGCGGCAGAGATGGCAAATAAGACCAAACCTGTGAACAT
GATGGATGATAAAATTGATGAAAAATACAGTGCATTTAAGCAATTCGATACTGTTGATGA
TCACAGTGATCATTATTATTCGAAGCCAGATTTAAGAAAGGTTCAGGTAGTGAAAAAGCC
TTCAAAAGAATGGGCAAAGCGTATTCAGCACGAGTGGAAAGTTCTAGAAAAAGATTTACC
AGATACCATATTCGTGAGGGCATATGAGGATAGAATGGACCTGCTTAGAGCTGTTATTAC
GGGACCAGCAGGCACTCCCTATCATGATGGTCTCTTCTTCTTTGACATTTACTTCCCTCC
TCATTATCCGAGTGTACCTCCACTGGTGAACTATCGGTCTGGTGGGTTGCGGCTTAATCC
AAACTTGTATGCTTGCGGGAAGGTGTGCCTTAGCCTGTTGAACACCTGGTCTGGTAGTGG
ATGTGAGAGGTGGAGTCCTTCAAACTCAACAATGCTACAAGTCCTGGTCTCAGTTCAGGC
TTTGGTGTTGAATGCCAAACCTTATTTCAATGAGCCTGGATATGCCATGCATGCTAATAC
ACCTCATGGCGAGAAGAGTTCATTAACTTATAATGAAGATACTTTCCTGCTATCCTGCAG
GACAATGCTATATTCTCTGCGAAATCCACCAAAGCATTTTGAGGATTTTATCGCCGGTCA
TTTCCGCAAGTATGGCCAGAGCATCCTGATAGCTTGCAGAGCCTATCTGGACGGTGCCCA
AGTTGGATGTCTTGTTGGAAATGGTGTGCAGGATGTCGATGAGGGCGACAAGAGCTGCTC
GGCGAGGTTTAAGAGCGCGCTGAAGAGATTATTTGAGGAACTTCTGATGGAATTCACTGT
CAAGGGAGCAGAGTGTGACAAATTCCTAGCTGAGAAGGCCAAAGCCGCGGCTTCTAGAGC
TCCAGCAGACACCACATTGAGGCTATAAGTTGATAGCCTCGCGTGGTCGATAGACGGGAG
TAATAATTTCGCTATTGAAATAGGATCCTCAACTCATTATGCCCCCGGATTCTAACCGTT
TCCTGGAAGTAGCCTATGTAAATAGCCTTGTAGTTGCCCCGGTAAACATAAACGACATAT
CCGTGTTTGTATTTAGGGGCTATATATCTTTTTTCCCCATAGCATGAGGGTGTCGTCTAC
CTGCGGAGCCTTAATCCGCTGTGTATGTGATTGACGCCACACCATCTTGGCCTTCTGAAG
AATATCATATTGAACTCTTATCAGCAGATCCCTGCTTCTACGCTGGAATTCAGCTAGAAT
GCTAGATTATCAGTTGGTTTGTGC

CDS

1530 bp

>Os05t0557600-01 Ubiquitin-conjugating enzyme/RWD-like domain containing protein.
ATGGCGACCCACGCCCCCAAGGGCTACCTCTGCGCGGGGAGCTCGTCGTTCGATGATCCC
GACGTGGTCGAGGTGACGCCGGCGGCGGCCGCGGCAGGGGGGTGGAGCTCCGGCCACCAG
AAGCGGAAGCGGAGTCAGGTTGTTCCTCATGAAGTAATTGAACTGGATGCTGATGATGAT
CCTGATGGAGTTGTGATTATTGGTGAAAAATCATCAGTTGATAAGAATAAGCAAGCTGTT
GGATATCCTATAGACTGGCTAAAGCATGCAAAGAGTAGTTTGGCTGGTGAAATTGCTGGC
CCAAGTTCCTACCCATCAAAAAATCCTGATATATTACTTGGTGGCCTGAAAATATTTCAA
GAGAACCCATTTTACAACAACATTGATGACTATGCTTATGAGGCATTTGAAGAAGATTAT
GGTTATGATGAAGATGAGTATGATGATTACGATTATGATAGTACACTTTATGAAAGTGAA
TATAACTTCACTTTGGCTTCCAAGTTTGATGGTTTGGATATCCCACCTGGTGTGGAGGCT
CCTTTACCATGGTTGCAGACGACTGCGGCAGAGATGGCAAATAAGACCAAACCTGTGAAC
ATGATGGATGATAAAATTGATGAAAAATACAGTGCATTTAAGCAATTCGATACTGTTGAT
GATCACAGTGATCATTATTATTCGAAGCCAGATTTAAGAAAGGTTCAGGTAGTGAAAAAG
CCTTCAAAAGAATGGGCAAAGCGTATTCAGCACGAGTGGAAAGTTCTAGAAAAAGATTTA
CCAGATACCATATTCGTGAGGGCATATGAGGATAGAATGGACCTGCTTAGAGCTGTTATT
ACGGGACCAGCAGGCACTCCCTATCATGATGGTCTCTTCTTCTTTGACATTTACTTCCCT
CCTCATTATCCGAGTGTACCTCCACTGGTGAACTATCGGTCTGGTGGGTTGCGGCTTAAT
CCAAACTTGTATGCTTGCGGGAAGGTGTGCCTTAGCCTGTTGAACACCTGGTCTGGTAGT
GGATGTGAGAGGTGGAGTCCTTCAAACTCAACAATGCTACAAGTCCTGGTCTCAGTTCAG
GCTTTGGTGTTGAATGCCAAACCTTATTTCAATGAGCCTGGATATGCCATGCATGCTAAT
ACACCTCATGGCGAGAAGAGTTCATTAACTTATAATGAAGATACTTTCCTGCTATCCTGC
AGGACAATGCTATATTCTCTGCGAAATCCACCAAAGCATTTTGAGGATTTTATCGCCGGT
CATTTCCGCAAGTATGGCCAGAGCATCCTGATAGCTTGCAGAGCCTATCTGGACGGTGCC
CAAGTTGGATGTCTTGTTGGAAATGGTGTGCAGGATGTCGATGAGGGCGACAAGAGCTGC
TCGGCGAGGTTTAAGAGCGCGCTGAAGAGATTATTTGAGGAACTTCTGATGGAATTCACT
GTCAAGGGAGCAGAGTGTGACAAATTCCTAGCTGAGAAGGCCAAAGCCGCGGCTTCTAGA
GCTCCAGCAGACACCACATTGAGGCTATAA

Protein

510 aa

>Os05t0557600-01 Ubiquitin-conjugating enzyme/RWD-like domain containing protein.
MATHAPKGYLCAGSSSFDDPDVVEVTPAAAAAGGWSSGHQKRKRSQVVPHEVIELDADDD
PDGVVIIGEKSSVDKNKQAVGYPIDWLKHAKSSLAGEIAGPSSYPSKNPDILLGGLKIFQ
ENPFYNNIDDYAYEAFEEDYGYDEDEYDDYDYDSTLYESEYNFTLASKFDGLDIPPGVEA
PLPWLQTTAAEMANKTKPVNMMDDKIDEKYSAFKQFDTVDDHSDHYYSKPDLRKVQVVKK
PSKEWAKRIQHEWKVLEKDLPDTIFVRAYEDRMDLLRAVITGPAGTPYHDGLFFFDIYFP
PHYPSVPPLVNYRSGGLRLNPNLYACGKVCLSLLNTWSGSGCERWSPSNSTMLQVLVSVQ
ALVLNAKPYFNEPGYAMHANTPHGEKSSLTYNEDTFLLSCRTMLYSLRNPPKHFEDFIAG
HFRKYGQSILIACRAYLDGAQVGCLVGNGVQDVDEGDKSCSARFKSALKRLFEELLMEFT
VKGAECDKFLAEKAKAAASRAPADTTLRL*

5'UTR

chr05:27738201..27738318 (- strand) : 118 bp

CDS

chr05:27738181..27738200 (- strand) : 20 bp

chr05:27737944..27738061 (- strand) : 118 bp

chr05:27736493..27736627 (- strand) : 135 bp

chr05:27735961..27736407 (- strand) : 447 bp

chr05:27735826..27735889 (- strand) : 64 bp

chr05:27735527..27735666 (- strand) : 140 bp

chr05:27735130..27735441 (- strand) : 312 bp

chr05:27734251..27734544 (- strand) : 294 bp

3'UTR

chr05:27733895..27734250 (- strand) : 356 bp

FASTA

>Os05t0557600-01 class=Sequence position=chr05:27733895..27738318 (- strand)
ACCCAAACCC TCCCTTTCCT CCCCCAATTC TCCATTTCTC CTAGCTCGCC GGAAACCCTA AGCGGGCCAC CTCGCGCCGC
GGCGGGCCGG CGAGCGATCG CATTGGGCGG CGGCGGCGAT GGCGACCCAC GCCCCCAAGT GAGTCCCCCC TCCCTCCGCC
GATCTGATCG GCCGCGCGCG CCGCTCTTTG TTCCATTGGA ATTTTTGTTT TTGTTTGTGA CGTGGTCGTG GTTGGTTGCT
GCTCTGGGTG GGGGCAGGGG CTACCTCTGC GCGGGGAGCT CGTCGTTCGA TGATCCCGAC GTGGTCGAGG TGACGCCGGC
GGCGGCCGCG GCAGGGGGGT GGAGCTCCGG CCACCAGAAG CGGAAGCGGA GTCAGGTGAT GTGGGAAGGC GCCTCCTCTA
TCTCACCTTT GTTTGTGGTG CATGATTTTA TTATTTTTTT TGGTGATGTT GGAATTGGGA ACCGTAGGGG GGACTGGGGC
GCGTGATTGC TCGATGTGGG AAGGAGGGTT GGTGATCGTT TTAATGGTTG CGTGTTGATT CCAGTTATGC CATGACCTGT
TATTTTGGTG TGGAATTGCA CTAGAATTGT GTGGGCAGAT GATCTTTGAT TGTGCCAGGA AATGGTTGAG ATGGACTGGC
AGTGGCAGTT TGATATATTG AATTTTGATC TTAGATGCGC TCAATGTTGA ATATCAAGTG GAGTTTGTGT TTTTTTTGTA
TGGTGAGAAG TTGGGCTGTT TTTGTTAGAT GATTGCTGAA TTATAGTTTA TGATTGCAGT ACTGAAATTT TTAGAGGGTT
TGATTGCATT GAAATGCCTG ATAAACCAAG CAGGAGAGAA GCAATCTAGA CTGTCTAGAC TTTAGAGTGA CACCATGTTT
CAGCCTGGTT CATGATGGAC TAGAATTCAT GTTGAAGGAA ATCTAGCATG GGACATCTTT GGTTGGGCTT TTGAGTGGTA
GTCTAGCATT CTCTGGCACT GCTTGAGTAA AAATCCTTGT TTGTTTCTTA TCTGGAGAGT TAGGCATGTA AATGTGATGT
TGGCATGTGC AATATTTTCA GTTCCAGAGT GGATGGGCAG ACTGAAAGTG CATGCCATTT GATTATTCTG TCTGTCTGTT
AGGTCAATTG TTCAATTATT TGACATCTTT ACCTACTACC CAATATTCTG GTTTAGACAT AATCTGACAT ATGACGTTGG
TAGTAGAGAC TGGAAGCTGT AAGTACATGT CATCTGATTA TTCCAGCTTA GTCTATTGGG TTGTTTGGTT CTTTGATGTC
TTTCTATAAC TCTAGGATTA TGTTTTAACA ATCATCTAAA ACTTGTGGTT AATCTAGAGA TGCCTCAAGT GAAATTTGTT
TGTTTAAAGG TGTCACTGGG CCTTCTTTTT CTTTCTGTAA CATATGATAT TTTGTGACCA AAAGCCCATC TCCATCAACC
ATCATTGTTG GAAATCAAGA TAGAGTTCAG ACTCCAAAGA ACATAAAGAG GCCAAATATA AAGATGAATA ATTAGTAGTA
ACCATGTCAG TTTTTATTCT ATGAACTCAG CATTGCCGTG ACGTTTCTGG CTTTTTCAGC CACCACGATT TCCTGTATAG
GATCAATTAT TTCCCTTCAA AACATTTTTG TAATATCATG TTATGAAATG TTAAATGGTG GGGCTTGAGT TTTTTTTTAT
ACGCTGAATA GGTTGTTCCT CATGAAGTAA TTGAACTGGA TGCTGATGAT GATCCTGATG GAGTTGTGAT TATTGGTGAA
AAATCATCAG TTGATAAGAA TAAGCAAGCT GTTGGATATC CTATAGACTG GCTAAAGCAT GCAAAGGTAA GTTTTCTCAT
GTCTTCTATT TTCATTTTCC TTTTTCCTAT ACCACGTCAG TTTGACTTAT TTTCTGTGGG AACAACTCCA GAGTAGTTTG
GCTGGTGAAA TTGCTGGCCC AAGTTCCTAC CCATCAAAAA ATCCTGATAT ATTACTTGGT GGCCTGAAAA TATTTCAAGA
GAACCCATTT TACAACAACA TTGATGACTA TGCTTATGAG GCATTTGAAG AAGATTATGG TTATGATGAA GATGAGTATG
ATGATTACGA TTATGATAGT ACACTTTATG AAAGTGAATA TAACTTCACT TTGGCTTCCA AGTTTGATGG TTTGGATATC
CCACCTGGTG TGGAGGCTCC TTTACCATGG TTGCAGACGA CTGCGGCAGA GATGGCAAAT AAGACCAAAC CTGTGAACAT
GATGGATGAT AAAATTGATG AAAAATACAG TGCATTTAAG CAATTCGATA CTGTTGATGA TCACAGTGAT CATTATTATT
CGAAGCCAGA TTTAAGAAAG GTTCAGGTAG TGAAAAAGGT AACCTTTTTT TTGTACCCTC TGTATATTCC TTTTCTTGTT
AGTTCGATAC TAAGTTTTCC CATTGACAGC CTTCAAAAGA ATGGGCAAAG CGTATTCAGC ACGAGTGGAA AGTTCTAGAA
AAAGATTTAC CAGGTAGTTT TGTTGCTTCA TATGCTCTTT TTTTTATGAA CAGCTAATGG TACAGTGTTT ATGCTAAGTG
TCGTGCATGA TGCGATCATG CTGTTGATAA GTACTACATT CATGAGGTCC TTTTATGATT ATTTACTTTG GATTTTTGTC
CTATATTTAC AGATACCATA TTCGTGAGGG CATATGAGGA TAGAATGGAC CTGCTTAGAG CTGTTATTAC GGGACCAGCA
GGCACTCCCT ATCATGATGG TCTCTTCTTC TTTGACATTT ACTTCCCTCC TCATTATCCG AGTGTACCTC CAGTAAGATT
TTTTTTTTGA CTTAACCAGC ATCGATGATG TTTCACTCCA TTTTTAAGTA TCTTACAATA GTTAGTAATC TATGCAGCTG
GTGAACTATC GGTCTGGTGG GTTGCGGCTT AATCCAAACT TGTATGCTTG CGGGAAGGTG TGCCTTAGCC TGTTGAACAC
CTGGTCTGGT AGTGGATGTG AGAGGTGGAG TCCTTCAAAC TCAACAATGC TACAAGTCCT GGTCTCAGTT CAGGCTTTGG
TGTTGAATGC CAAACCTTAT TTCAATGAGC CTGGATATGC CATGCATGCT AATACACCTC ATGGCGAGAA GAGTTCATTA
ACTTATAATG AAGATACTTT CCTGCTATCC TGCAGGACAA TGCTATATTC TCTGCGAAAT CCACCAAAGG TATGGATATG
ACTCTGTTCT TATCCTAGTA CATGGAGATG ATTACTTATT TTCATAATAG TACTAAAGTT GTTTGATGAA TATCTAGACA
TCTACTGTAA AATCTCTCTT GTTTGATGAA TATTTCATCC ATTAAAGGTC TCTTTGCAAT CTCCTCTCGA AATATACATA
TTTATTGATG TTTCTCATTT TCGCACTCGT ATGTTCCTTT CGTCAATATT AATTAGTAAT AATTTACACA GTTACACTAA
CTATTCTCAA TTATTTTGAA GACATTAACA TTGCGATCAT CTTTACCATT CCTTCTACTA GTCTTTGTTA TTATTATAGC
ATCCATAATT ACCATGCCTA ACCAAAATAT GTCACAAAAG GAAATGGAGT GATTACTATG GGAAGCTATT GTTGTGCTTA
TGTGGTTGCA TGCCATGGAT TCCCCACTAT GAATAGATAT ACCTGTACAT CTTCTTAACA ATTTATCTTT TTGTTGTGGT
TCTTTTACAG TGGAAATATG TGTTGTTTAG TTTCTGTTAT TTTGGATCCA ATCTTCACAT CTGCAAATTT AATACTAATG
CATTTTTTTT GCAGCATTTT GAGGATTTTA TCGCCGGTCA TTTCCGCAAG TATGGCCAGA GCATCCTGAT AGCTTGCAGA
GCCTATCTGG ACGGTGCCCA AGTTGGATGT CTTGTTGGAA ATGGTGTGCA GGATGTCGAT GAGGGCGACA AGAGCTGCTC
GGCGAGGTTT AAGAGCGCGC TGAAGAGATT ATTTGAGGAA CTTCTGATGG AATTCACTGT CAAGGGAGCA GAGTGTGACA
AATTCCTAGC TGAGAAGGCC AAAGCCGCGG CTTCTAGAGC TCCAGCAGAC ACCACATTGA GGCTATAAGT TGATAGCCTC
GCGTGGTCGA TAGACGGGAG TAATAATTTC GCTATTGAAA TAGGATCCTC AACTCATTAT GCCCCCGGAT TCTAACCGTT
TCCTGGAAGT AGCCTATGTA AATAGCCTTG TAGTTGCCCC GGTAAACATA AACGACATAT CCGTGTTTGT ATTTAGGGGC
TATATATCTT TTTTCCCCAT AGCATGAGGG TGTCGTCTAC CTGCGGAGCC TTAATCCGCT GTGTATGTGA TTGACGCCAC
ACCATCTTGG CCTTCTGAAG AATATCATAT TGAACTCTTA TCAGCAGATC CCTGCTTCTA CGCTGGAATT CAGCTAGAAT
GCTAGATTAT CAGTTGGTTT GTGC

Locus: Os05g0557600

Loading...

Locus: Os05g0557600

Loading...