Os05t0557700-01

Locus

Os05g0557700

Description

Ubiquitin-conjugating E2 enzyme, Phosphate homeostasis, Negative regulator of the inorganic phosphate (Pi)-starvation response-signaling pathway

RAP-DB Gene Symbol Synonym(s)

LTN1, OsPHO2, PHO2.1, OsUBC35, UBC35

RAP-DB Gene Name Synonym(s)

LEAF TIP NECROSIS 1, Leaf tip necrosis1, Phosphate Overaccumulator2, PHOSPHATE2, Ubiquitin-conjugating enzyme 35

CGSNL Gene Symbol

LTN1

CGSNL Gene Name

LEAF TIP NECROSIS 1

Oryzabase Gene Symbol Synonym(s)

LTN1, OsPHO2, PHO2.1, PHO2.2, PHO2, OsUBC35, UBC35

Oryzabase Gene Name Synonym(s)

Leaf tip necrosis1, Phosphate Overaccumulator2, PHOSPHATE2, Ubiquitin-conjugating enzyme 35

Transcript Evidence

AK241747

Protein Evidence

B7F902

Literature

PMID: 27895204

PMID: 24249833

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

January 10, 2017

Functional domain (InterPro)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme E2 (IPR000608)

Full-length cDNA

J065202E18 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0557700-01)

Others

Oryzabase (9255)

Transcript

4113 bp

>Os05t0557700-01 Ubiquitin-conjugating E2 enzyme, Phosphate homeostasis, Negative regulator of the inorganic phosphate (Pi)-starvation response-signaling pathway
GCACCATAGAAATCACCAGGACCCATCGCAAGAGCAGCAGCCTAGCGGAGCACCGAGCAA
GAACAAGCAGCAGCAGCAGCAGCAGCAGAAGCAGAAGCAGTAGAAGAAGAAGCTTTTCTT
GCTTTGCTTGCTTTCTCTCTCTCTAGGCTCCATCTCCTCCCTCCACCACTGCGTCTCGAA
ATATCCGGCTTTCTTGTTGTGCGATTTGGTGCGAGGTGGTGGTGATTGCTTCGTCGGCTG
TTGATTTCTTCGAGGAATTGGAGCTGTGTTGGGGGATTCAGGGGGGCTTCATGGTCGAAG
GGCTCGGGGATGGATTGAGGCGTGGGAGAAGAGGAGCTTAGCTTCCTCTTCTTCTTCGGT
GATCGGGTTTGGGGTTCTTGGAATCGCGAGGAGGCGGGACATGGCGGGAGATTGGGCTTG
TCACAGACTCAGGGCCTGCTGATCAATGCAAATAGACTTGAAAGAACATTATATTCTCGT
GATCTTATCAAGTGAAGCCATATCTAATGAAAGCTTGTTATATTTGTTGCTTTCTTGATG
AGATTTGTTGCTTATGACCACTTGTGTCCTCTAATCATCCAAAGCAAAAAAAATCATTCA
GCCGGTCTTTACCTCTCCAGGAATTAACACCTGTGACAAGTTATTCCTTGTTTTAGGGCA
AATCTCCTTTGGCAATTGCACCTTCCTGTCGATCGATTATCCTGAGCATATTCCTCTTAT
TGAGAGAACCCTTCAGCTGGGCAAATCTCCTTTGGCAAAATACCTATCTATAGTCTGTCT
ATTCGGGCAAATCTCCTTTGGCATTTAGCTTAGATTGCTTCCGGGCAAATCTCCTTTGGC
ACTACCTTTAGCTTCAGATTGCTCTTTGGGCAAATCTCCTTTGGCACTAGGTACTCTACT
ACTATCCGCATTAGATATTTGGATCAAATATCCTCTGGAAGTTAGTGGTATTACATCATT
ATTTCCTGCAACTATATATCGTGGTAATTCTCCTTTGGCATTAGCACTGTACACACATTG
GTTCTACCACAATATCGATCTCAGTGAAAGACTGAACACCAGGAAGTCCAGAACGATTCA
AGAAATAATTTTTGGCTGGTGGCCGTTGTATTTTAGCATCTTGGACAGGAAGCTTTCAGA
TTCTGATTGTTCAGTCTGGAAGATTGTTTTGTTATTTATCAACTCTATACATCAGTGCGC
CTATCCTAAGAAGGGCTCGGAAAGATGGATCTATATGCAATTGACTCGGACACTGAGTCA
TACGCTGAAACTAGTGACAGTGAAGAAGACCAAGAAGAATGTGAACTTACATACTGTGGT
CATGCCCAGAACATCTTGTCCAGCTTGGACGAGAGCATTGGAAAGATCGATAACTTTCTA
AGTTTTGAAAGAGGATTTCTGCATGGAGACATAGTTTGCTCTGCAGCTGACCCATCAGGT
CAGCTGGGCCGTGTAGTTGGAGTTGATATGCTTGTTGACTTGGAAACGAGCTCTGGTGAC
ATAATAAAACATGTCAACAGCAAGAAACTTTCAAGAGTTAGATCCTTTGTCTCTGGTGAT
TGTGTGGTGATGGGGCCATGGATTGGACGGGTGATCAGGGCATTTGACCTGGTCACTGTT
GTGTTCAGTGATGGGGCAAGGTGTGAAATGCTCTTAAGAGATTCTGAGGTACTGAAGCCC
ATTCCTCCAATCCTTTTTGAAGATGCACCTTATTTTTACTATCCAGGCCAACGTGTGAGA
ATTGTTCATCCTTCCATTTCTAAGTCGGGTACATGGTTGTGTGGATCATGGAAAGCTAGT
AGAGATGAAGGAGTAGTGTCTCATGTCGACGTTGGGCTGGTACATGTGAACTGGATCACC
TCAGTAACAAATGTTTGGGGAGGTCAATCATCAAGTCCTCCAAACTTTCAGGACCCAAAG
AAGCTCACTTTGCTTTCATGCTTCCCTTATGCCAATTGGCAGTTGGGTGACTGGTGCACT
CTTTCGGATTGCGAGGGAAGTCTCTGGGAAAATTCTGACAAATCTTGCTTCATGAGTATG
ACCTGGAAGTCCAGCTCCGACACTCAAACGGCTATCGGAACTTATGGTTCAGATTATTCT
CAAACATATGTTGTTGCAAAGACAAAGAGTAGTGTTGATGTTTTATGGCAAGATGGAAGT
ACATCTCTTGGTTTAGAACCTCAAAGTTTGGTTCCTGTGAGTACTCTTGGTGATCATGAT
TTTTGGCCTGGGCAATTTATCCTTGAGAAATTGACAGTTGAGGATAATGGTAGATGCCAG
CGGACTGGGATAGTGACAAGTGTGGATGCACTTGAACGGACTGTAAAGGTAAAATGGGCT
GTTTCAGTTGATAGTGACACTGTCAGTTATGGAGATGGACTCACTGAGGAGACTGTGAGT
GCTTATGAGCTAGTATTACACCCAGATTTCTCCTTCTTCACTGGCGAAGTCATTATTAGA
TCTGCTGTCAACATAGAAAATTCTGAAGCAAATCTTACCAATGGAACCGTGGCAGTTAGC
AGGGAGAGCTTGGATACCTCCTCTGCCTTCTTATCATGTATTGGCAATGTTCTTGGATAC
AATGATGAAGGACTTGAAGTCCAATGGGCTAGTGGTGCGATATCTAGGGTTCAGCATTTT
GAAATTATTGCATTAGATAGGATTCTAGATGATTCTCTAGAATCCATGATCGAGGAGCAC
ACTACTGATGATTTGGTAGACATGGCTGAGCAGGAGAAAATGCACCTTGAGGATACTAAG
AGTGCGCTGGAAGAATCTGCTGGAGACTGTACAGGATCCTTGCGCAAAGCCACTGCTTTC
CTCTTTTCCAAGACAGCATTTAATTTTCTGACAAATGTGGCTTCTAGTTTGTTTGGTGCT
CATGATTCAACATTTTCCAGCTCGGTCAATGCAGATTCTCAGTATCAAATTGTGACGACA
GCAGAACTGCAGCCATCTGCAGAAGATATCTCTGAAGAGAAACAGACCATGGAGCTGATA
ACACAGTTTGAGAAGCCAACATTAGCTTCAGAAAATGCCATGACAAAAGGATTTGATGTT
GTGACCGACTGTTCTGATCACCACTTTGTCAAAGAAATTGGTCACGAAAATGTCAAAAGA
GGTTGGGTGAAGAAGATACAACAGGAATGGTCAATCTTACAAAACGATCTGCCAGATGGT
ATTCATGTTAGAGTTTATGAAGAAAGGATGGACCTCCTGAGGGCATGCCTTGTAGGTGCA
GCTGGAACACCTTATCATGACAATCTTTTCTTCTTTGATATTTTCTTTCCTCCTGATTAT
CCTCATGAGCCACCTTCTGTTCACTACCATTCCGGTGGCCTCCGTTTGAACCCAAATTTG
TATGAGTCTGGCAAAGTGTGCCTTAGCCTGCTCAAAACATGGGCAGGAACTGGTAGTGAA
GTGTGGGACCCTGAAAATTCAACTGTTCTTCAACTGCTGCTGTCCCTTCAAGCTCTTGTT
CTCAATGAAAAACCTTACTTCAATGAGGCTGGCTATGACAAATTCATGGGGAAAGCAGAT
GGAGAGAAGAACTCCATCACTTACAATGAGAACGCTTTCCTGCTGTCATGCAAGTCCATG
ACGTACATTTTACACAAGCCACCAAAGCATTTCGAGAATTTTGTCAAGGAGCACTTCACT
TGTTGCGCGCCGCACATTCTGGATGCCTGCAAGGCTTATCTCGGCGGCGATCTTGTTGGA
CATGCTCGTGACAGCGCCTATATATCGGATGACGGATGCAAGAACTCCTCAACCGGTTTC
AAGATAATGCTAGCCAAGCTCTTGCCGAAGCTTGTCACCACCTTCTCTGAAGCCGGCATC
CCCTGCAGCCCGTGACTCATGGCATTGTGAGTTTGTGACACTGGACTACTGTGTATTTGT
GACAAAATCGGGACACCAATATATGCTGTGTATGTACTGTATATGTGCAAGCTTTGTGAC
TTTGTGTATCCCAAAATAAAATGCTGCCTGGTTTGTATGATACTTAACATGGTGATGTCT
GTTGTAACTTGTAAGTGTGGTTGAGGCAGCTGGTGTGGTTGGGTTTGTGGTCAGTTACTC
AGTTCACGTGTGTTTTGAGCATGTGAAGTATGT

CDS

2631 bp

>Os05t0557700-01 Ubiquitin-conjugating E2 enzyme, Phosphate homeostasis, Negative regulator of the inorganic phosphate (Pi)-starvation response-signaling pathway
ATGGATCTATATGCAATTGACTCGGACACTGAGTCATACGCTGAAACTAGTGACAGTGAA
GAAGACCAAGAAGAATGTGAACTTACATACTGTGGTCATGCCCAGAACATCTTGTCCAGC
TTGGACGAGAGCATTGGAAAGATCGATAACTTTCTAAGTTTTGAAAGAGGATTTCTGCAT
GGAGACATAGTTTGCTCTGCAGCTGACCCATCAGGTCAGCTGGGCCGTGTAGTTGGAGTT
GATATGCTTGTTGACTTGGAAACGAGCTCTGGTGACATAATAAAACATGTCAACAGCAAG
AAACTTTCAAGAGTTAGATCCTTTGTCTCTGGTGATTGTGTGGTGATGGGGCCATGGATT
GGACGGGTGATCAGGGCATTTGACCTGGTCACTGTTGTGTTCAGTGATGGGGCAAGGTGT
GAAATGCTCTTAAGAGATTCTGAGGTACTGAAGCCCATTCCTCCAATCCTTTTTGAAGAT
GCACCTTATTTTTACTATCCAGGCCAACGTGTGAGAATTGTTCATCCTTCCATTTCTAAG
TCGGGTACATGGTTGTGTGGATCATGGAAAGCTAGTAGAGATGAAGGAGTAGTGTCTCAT
GTCGACGTTGGGCTGGTACATGTGAACTGGATCACCTCAGTAACAAATGTTTGGGGAGGT
CAATCATCAAGTCCTCCAAACTTTCAGGACCCAAAGAAGCTCACTTTGCTTTCATGCTTC
CCTTATGCCAATTGGCAGTTGGGTGACTGGTGCACTCTTTCGGATTGCGAGGGAAGTCTC
TGGGAAAATTCTGACAAATCTTGCTTCATGAGTATGACCTGGAAGTCCAGCTCCGACACT
CAAACGGCTATCGGAACTTATGGTTCAGATTATTCTCAAACATATGTTGTTGCAAAGACA
AAGAGTAGTGTTGATGTTTTATGGCAAGATGGAAGTACATCTCTTGGTTTAGAACCTCAA
AGTTTGGTTCCTGTGAGTACTCTTGGTGATCATGATTTTTGGCCTGGGCAATTTATCCTT
GAGAAATTGACAGTTGAGGATAATGGTAGATGCCAGCGGACTGGGATAGTGACAAGTGTG
GATGCACTTGAACGGACTGTAAAGGTAAAATGGGCTGTTTCAGTTGATAGTGACACTGTC
AGTTATGGAGATGGACTCACTGAGGAGACTGTGAGTGCTTATGAGCTAGTATTACACCCA
GATTTCTCCTTCTTCACTGGCGAAGTCATTATTAGATCTGCTGTCAACATAGAAAATTCT
GAAGCAAATCTTACCAATGGAACCGTGGCAGTTAGCAGGGAGAGCTTGGATACCTCCTCT
GCCTTCTTATCATGTATTGGCAATGTTCTTGGATACAATGATGAAGGACTTGAAGTCCAA
TGGGCTAGTGGTGCGATATCTAGGGTTCAGCATTTTGAAATTATTGCATTAGATAGGATT
CTAGATGATTCTCTAGAATCCATGATCGAGGAGCACACTACTGATGATTTGGTAGACATG
GCTGAGCAGGAGAAAATGCACCTTGAGGATACTAAGAGTGCGCTGGAAGAATCTGCTGGA
GACTGTACAGGATCCTTGCGCAAAGCCACTGCTTTCCTCTTTTCCAAGACAGCATTTAAT
TTTCTGACAAATGTGGCTTCTAGTTTGTTTGGTGCTCATGATTCAACATTTTCCAGCTCG
GTCAATGCAGATTCTCAGTATCAAATTGTGACGACAGCAGAACTGCAGCCATCTGCAGAA
GATATCTCTGAAGAGAAACAGACCATGGAGCTGATAACACAGTTTGAGAAGCCAACATTA
GCTTCAGAAAATGCCATGACAAAAGGATTTGATGTTGTGACCGACTGTTCTGATCACCAC
TTTGTCAAAGAAATTGGTCACGAAAATGTCAAAAGAGGTTGGGTGAAGAAGATACAACAG
GAATGGTCAATCTTACAAAACGATCTGCCAGATGGTATTCATGTTAGAGTTTATGAAGAA
AGGATGGACCTCCTGAGGGCATGCCTTGTAGGTGCAGCTGGAACACCTTATCATGACAAT
CTTTTCTTCTTTGATATTTTCTTTCCTCCTGATTATCCTCATGAGCCACCTTCTGTTCAC
TACCATTCCGGTGGCCTCCGTTTGAACCCAAATTTGTATGAGTCTGGCAAAGTGTGCCTT
AGCCTGCTCAAAACATGGGCAGGAACTGGTAGTGAAGTGTGGGACCCTGAAAATTCAACT
GTTCTTCAACTGCTGCTGTCCCTTCAAGCTCTTGTTCTCAATGAAAAACCTTACTTCAAT
GAGGCTGGCTATGACAAATTCATGGGGAAAGCAGATGGAGAGAAGAACTCCATCACTTAC
AATGAGAACGCTTTCCTGCTGTCATGCAAGTCCATGACGTACATTTTACACAAGCCACCA
AAGCATTTCGAGAATTTTGTCAAGGAGCACTTCACTTGTTGCGCGCCGCACATTCTGGAT
GCCTGCAAGGCTTATCTCGGCGGCGATCTTGTTGGACATGCTCGTGACAGCGCCTATATA
TCGGATGACGGATGCAAGAACTCCTCAACCGGTTTCAAGATAATGCTAGCCAAGCTCTTG
CCGAAGCTTGTCACCACCTTCTCTGAAGCCGGCATCCCCTGCAGCCCGTGA

Protein

877 aa

>Os05t0557700-01 Ubiquitin-conjugating E2 enzyme, Phosphate homeostasis, Negative regulator of the inorganic phosphate (Pi)-starvation response-signaling pathway
MDLYAIDSDTESYAETSDSEEDQEECELTYCGHAQNILSSLDESIGKIDNFLSFERGFLH
GDIVCSAADPSGQLGRVVGVDMLVDLETSSGDIIKHVNSKKLSRVRSFVSGDCVVMGPWI
GRVIRAFDLVTVVFSDGARCEMLLRDSEVLKPIPPILFEDAPYFYYPGQRVRIVHPSISK
SGTWLCGSWKASRDEGVVSHVDVGLVHVNWITSVTNVWGGQSSSPPNFQDPKKLTLLSCF
PYANWQLGDWCTLSDCEGSLWENSDKSCFMSMTWKSSSDTQTAIGTYGSDYSQTYVVAKT
KSSVDVLWQDGSTSLGLEPQSLVPVSTLGDHDFWPGQFILEKLTVEDNGRCQRTGIVTSV
DALERTVKVKWAVSVDSDTVSYGDGLTEETVSAYELVLHPDFSFFTGEVIIRSAVNIENS
EANLTNGTVAVSRESLDTSSAFLSCIGNVLGYNDEGLEVQWASGAISRVQHFEIIALDRI
LDDSLESMIEEHTTDDLVDMAEQEKMHLEDTKSALEESAGDCTGSLRKATAFLFSKTAFN
FLTNVASSLFGAHDSTFSSSVNADSQYQIVTTAELQPSAEDISEEKQTMELITQFEKPTL
ASENAMTKGFDVVTDCSDHHFVKEIGHENVKRGWVKKIQQEWSILQNDLPDGIHVRVYEE
RMDLLRACLVGAAGTPYHDNLFFFDIFFPPDYPHEPPSVHYHSGGLRLNPNLYESGKVCL
SLLKTWAGTGSEVWDPENSTVLQLLLSLQALVLNEKPYFNEAGYDKFMGKADGEKNSITY
NENAFLLSCKSMTYILHKPPKHFENFVKEHFTCCAPHILDACKAYLGGDLVGHARDSAYI
SDDGCKNSSTGFKIMLAKLLPKLVTTFSEAGIPCSP*

5'UTR

chr05:27747352..27747783 (- strand) : 432 bp

chr05:27744971..27745620 (- strand) : 650 bp

chr05:27744738..27744868 (- strand) : 131 bp

chr05:27744608..27744618 (- strand) : 11 bp

CDS

chr05:27743204..27744607 (- strand) : 1404 bp

chr05:27742902..27743033 (- strand) : 132 bp

chr05:27742674..27742817 (- strand) : 144 bp

chr05:27742395..27742601 (- strand) : 207 bp

chr05:27742217..27742280 (- strand) : 64 bp

chr05:27741518..27741657 (- strand) : 140 bp

chr05:27741109..27741420 (- strand) : 312 bp

chr05:27740476..27740703 (- strand) : 228 bp

3'UTR

chr05:27740218..27740475 (- strand) : 258 bp

FASTA

>Os05t0557700-01 class=Sequence position=chr05:27740218..27747783 (- strand)
GCACCATAGA AATCACCAGG ACCCATCGCA AGAGCAGCAG CCTAGCGGAG CACCGAGCAA GAACAAGCAG CAGCAGCAGC
AGCAGCAGAA GCAGAAGCAG TAGAAGAAGA AGCTTTTCTT GCTTTGCTTG CTTTCTCTCT CTCTAGGCTC CATCTCCTCC
CTCCACCACT GCGTCTCGAA ATATCCGGCT TTCTTGTTGT GCGATTTGGT GCGAGGTGGT GGTGATTGCT TCGTCGGCTG
TTGATTTCTT CGAGGAATTG GAGCTGTGTT GGGGGATTCA GGGGGGCTTC ATGGTCGAAG GGCTCGGGGA TGGATTGAGG
CGTGGGAGAA GAGGAGCTTA GCTTCCTCTT CTTCTTCGGT GATCGGGTTT GGGGTTCTTG GAATCGCGAG GAGGCGGGAC
ATGGCGGGAG ATTGGGCTTG TCACAGACTC AGGTATGGAT TGCATTCTCC TCTCGAATTT GGTTTCTTTC CGGCTGCCCT
CCGCGCAGCC CCTGCCCCGG CGAGGCTGGC CGGCGGCGAC TGCCACCCCG CCGCCGGTGA TGTGCGTGCA AGAATTGCGC
TTCAATGGCG AATTTCCTTG TGTTGTCTCG ATTTTGACCA TCACGTTTAC ATGGTTAAAA ATGGTAGTAG TCTTTAGAAA
AAATGGAAGA TTCAGGTGTT CATCGTTAGC TCTTGATAGC AATGCGTCTG ATTTTTTTTT CTTTTTTTGG GTCAGTCTTT
GAGACTTAGG ATTGTTGGAT TGGGGGAGAT TTGTCATATA TGAGTACTTT GTGGGTGCTA CGAATTGTTT TCGCGCCATT
TTTTCTTCTG GTTTTTGGGA GAGCGTGATT AGCACGGAAG GTAGTTTGTT GGATTTGATT AGTTACGTCG GAAAGGTTAA
ATATTAGCTG CTTATGTCGA CTACGATGTT GAAATGTCTG AGATTTTTCT GTACTGTTGT TTCAATCAAG AAGGCACCCA
AACTGGCAAT TCCAAGTAAA AAAAAACTAT GTTTTATAAC CTACTAGGTT CGTCtaattt atgcatgatt gatcatttct
tgcgttaata atatgggcat gattttctgt tgatgttttg ttttcgctcg tatgttaatc cttTAGATAT GGACTTTCAG
ATGTTTCCTT GTAGTATTAG TTTTGATTTG ACCCCTATCT GTATGTGGTC TTTTAATAGT AAAATCTAAC CATATAAATG
TGCAGATATT TGGAGTAAAA TTCTTCTATT TACATTTCTT TCAACGACTG TTATCTGAAT TTTTTTGCGT GCAGTTTGAT
TTTATACTCT CTTTTGCAAG TAACGTTAAT AATTTTTTTA ATCTTAATAG TTTTTTGTGT CAGTTTAAAG CCTTAAGCTG
GTTTGTAAGT ACCAATGATT TAGAATTTTA GATACTTTTA CTTTCGATTG ACTGTTACGT AGCAGGATCA TACTGCAGAA
TGCTCATCTG TGAGCTTTCT ATAGGCTCTT TACTCTCTCT TTTAACATCT GCTATGCTGT ATTGCAAACT AGCTATTCAT
TATGTTTCCT GAATAATGAA AATGTGTGTC TGCCGGTCTG CCCCTGTTTG GATAAGAAAA TTTCAAGTAC TGGCATATAA
AGGAAAATGG ACTATTTCAG GCAAATATTC ATTTTTGCTT GTTATGAGAC TTATATTATT TTACTTTAGA TACCTTTACT
ATCAACAAGT GGTGGTTGAT TCATATCCTA CCCTTTTTTG TGTGTAGAGC TGTAAATGCT TAACCATGAG CATTGTAGTA
TGTACATGAG TTAGTTCCTT GTAGAACTCA AATTATCGTC AAATCATCAT ACTAAAGTAT CCGTACAAGA TTCATTGTAC
AAAACCTTTT TTTTTGGTAA AATTTTTTTC GATAATGTTT TGGTAAAATT TGCATCCTAT CAACAAGCAA CATGAAACCA
TGCATATACA TATATGTAGA GTTGTAAATG ATCCTTTTTT TTTATATCCT CAAAAAGACC AAAACGCACG CATATGTCCA
GCACAAACAT TTGTAGCAAC ATATAAATCT TTATGAGGTT GATCTTTGTG CCTAATAATG CCTTTTGATG AGAGTGTTCT
CTAAAGCATC TAAGATACTA ATATTTTTCT CAATTTGGAT TGTCGTGACC AATTGGACTG AAGTTCTCAC CACATGTTTG
CAGGGCCTGC TGATCAATGC AAATAGACTT GAAAGAACAT TATATTCTCG TGATCTTATC AAGTGAAGCC ATATCTAATG
AAAGCTTGTT ATATTTGTTG CTTTCTTGAT GAGATTTGTT GCTTATGACC ACTTGTGTCC TCTAATCATC CAAAGCAAAA
AAAATCATTC AGCCGGTCTT TACCTCTCCA GGAATTAACA CCTGTGACAA GTTATTCCTT GTTTTAGGGC AAATCTCCTT
TGGCAATTGC ACCTTCCTGT CGATCGATTA TCCTGAGCAT ATTCCTCTTA TTGAGAGAAC CCTTCAGCTG GGCAAATCTC
CTTTGGCAAA ATACCTATCT ATAGTCTGTC TATTCGGGCA AATCTCCTTT GGCATTTAGC TTAGATTGCT TCCGGGCAAA
TCTCCTTTGG CACTACCTTT AGCTTCAGAT TGCTCTTTGG GCAAATCTCC TTTGGCACTA GGTACTCTAC TACTATCCGC
ATTAGATATT TGGATCAAAT ATCCTCTGGA AGTTAGTGGT ATTACATCAT TATTTCCTGC AACTATATAT CGTGGTAATT
CTCCTTTGGC ATTAGCACTG TACACACATT GGTTCTACCA CAATATCGAT CTCAGTGAAA GACTGAACAC CAGGAAGTCC
AGAACGATTC AAGGTAATTT GTCCTCTTTT ATGGTGTATA TTTTTTATGT GAGCCGTCAT TTTCTATAAT ATTTATTCAC
TTACAAAAGC TTTCCTATTT TGACTCAATT TTCAGAAATA ATTTTTGGCT GGTGGCCGTT GTATTTTAGC ATCTTGGACA
GGAAGCTTTC AGATTCTGAT TGTTCAGTCT GGAAGATTGT TTTGTTATTT ATCAACTCTA TACATCAGTG CGCCTATCCT
AAGAAGGTGA GCATGTAGTT AATAGTATAT TTCCTTTAAA TATTTCTGTG TCTATTCCAT TATCTAAAAA ATATATATTT
CTGTGTCTGA TTCCATGTGA AAAATGACAA CGTACTTTGT TTTAGGGCTC GGAAAGATGG ATCTATATGC AATTGACTCG
GACACTGAGT CATACGCTGA AACTAGTGAC AGTGAAGAAG ACCAAGAAGA ATGTGAACTT ACATACTGTG GTCATGCCCA
GAACATCTTG TCCAGCTTGG ACGAGAGCAT TGGAAAGATC GATAACTTTC TAAGTTTTGA AAGAGGATTT CTGCATGGAG
ACATAGTTTG CTCTGCAGCT GACCCATCAG GTCAGCTGGG CCGTGTAGTT GGAGTTGATA TGCTTGTTGA CTTGGAAACG
AGCTCTGGTG ACATAATAAA ACATGTCAAC AGCAAGAAAC TTTCAAGAGT TAGATCCTTT GTCTCTGGTG ATTGTGTGGT
GATGGGGCCA TGGATTGGAC GGGTGATCAG GGCATTTGAC CTGGTCACTG TTGTGTTCAG TGATGGGGCA AGGTGTGAAA
TGCTCTTAAG AGATTCTGAG GTACTGAAGC CCATTCCTCC AATCCTTTTT GAAGATGCAC CTTATTTTTA CTATCCAGGC
CAACGTGTGA GAATTGTTCA TCCTTCCATT TCTAAGTCGG GTACATGGTT GTGTGGATCA TGGAAAGCTA GTAGAGATGA
AGGAGTAGTG TCTCATGTCG ACGTTGGGCT GGTACATGTG AACTGGATCA CCTCAGTAAC AAATGTTTGG GGAGGTCAAT
CATCAAGTCC TCCAAACTTT CAGGACCCAA AGAAGCTCAC TTTGCTTTCA TGCTTCCCTT ATGCCAATTG GCAGTTGGGT
GACTGGTGCA CTCTTTCGGA TTGCGAGGGA AGTCTCTGGG AAAATTCTGA CAAATCTTGC TTCATGAGTA TGACCTGGAA
GTCCAGCTCC GACACTCAAA CGGCTATCGG AACTTATGGT TCAGATTATT CTCAAACATA TGTTGTTGCA AAGACAAAGA
GTAGTGTTGA TGTTTTATGG CAAGATGGAA GTACATCTCT TGGTTTAGAA CCTCAAAGTT TGGTTCCTGT GAGTACTCTT
GGTGATCATG ATTTTTGGCC TGGGCAATTT ATCCTTGAGA AATTGACAGT TGAGGATAAT GGTAGATGCC AGCGGACTGG
GATAGTGACA AGTGTGGATG CACTTGAACG GACTGTAAAG GTAAAATGGG CTGTTTCAGT TGATAGTGAC ACTGTCAGTT
ATGGAGATGG ACTCACTGAG GAGACTGTGA GTGCTTATGA GCTAGTATTA CACCCAGATT TCTCCTTCTT CACTGGCGAA
GTCATTATTA GATCTGCTGT CAACATAGAA AATTCTGAAG CAAATCTTAC CAATGGAACC GTGGCAGTTA GCAGGGAGAG
CTTGGATACC TCCTCTGCCT TCTTATCATG TATTGGCAAT GTTCTTGGAT ACAATGATGA AGGACTTGAA GTCCAATGGG
CTAGTGGTGC GATATCTAGG GTAAGCTTAA CTTTGAGAAA CTTTCTTCTC TTTTTTTTGT TGCTTTGATT TATTTTATTT
ACAGAAGTGT TGCTTTACTT TATACCAGTT TTATTTCCAA ACTTTGATGA AACATGGATC GGTCCCTGGT CAGACTAATG
ATAACATAAC TTATCTTGTA CAAATTTCAG GTTCAGCATT TTGAAATTAT TGCATTAGAT AGGATTCTAG ATGATTCTCT
AGAATCCATG ATCGAGGAGC ACACTACTGA TGATTTGGTA GACATGGCTG AGCAGGAGAA AATGCACCTT GAGGATACTA
AGGTCCGCTT CTGTCTACAA ATTCCATTGT ACGGTTATTA AACTTATGGG TTGAAATTTC ATCGATGATT TATCATTTTC
ATTCAGAGTG CGCTGGAAGA ATCTGCTGGA GACTGTACAG GATCCTTGCG CAAAGCCACT GCTTTCCTCT TTTCCAAGAC
AGCATTTAAT TTTCTGACAA ATGTGGCTTC TAGTTTGTTT GGTGCTCATG ATTCAACATT TTCCAGCTCG GTAAGTTCTA
TTTCTCTCTA GATGATGCAA GCTAAATTTT TATAGAATTC TGAGACAACG GCATTGTTTC AGGTCAATGC AGATTCTCAG
TATCAAATTG TGACGACAGC AGAACTGCAG CCATCTGCAG AAGATATCTC TGAAGAGAAA CAGACCATGG AGCTGATAAC
ACAGTTTGAG AAGCCAACAT TAGCTTCAGA AAATGCCATG ACAAAAGGAT TTGATGTTGT GACCGACTGT TCTGATCACC
ACTTTGTCAA AGAAATTGGT CACGAAAATG TAATGGTTTA CTTAGTGCAA CTTTCTTTCT TTATTTTTCT AGCAAATTGC
AATGCCTATT AATATTGGAG TATATGCAAT TCAATGTCAT AATAATTATT TCTGTTCTTC TAGGTCAAAA GAGGTTGGGT
GAAGAAGATA CAACAGGAAT GGTCAATCTT ACAAAACGAT CTGCCAGGTT TGTTTTCTTC TCTCATTGTA TAGTTTATTC
AGTTGCAACT CTTCATTAAG TCTTGTTGTT AAATTTGATA TTTTGGCATA TGTTTATTTT AATTTTAATT TCTGAGCTAG
CATGGCTTAA TACTGACGAT CCTTATATCC CACTATTTTT TTACTTGATA TGACATGTAT ATACTTGTGG TCAAAGATAG
GAATAAGTTA AAATTTTCTA CATTCCACAG GATAGCATAG CATGTGAGAA TCCCAGAAAC AATCAATCTC GGTAGCAAGT
ATGCAAGGAG ATGAGTGGAG TTATAAAGGC AAAATTTATT TTAGTTTTAT CATGTATGTG ACCTGTTATT ATTTAATAAA
TCATTACTTG TTAATCAGTG GGAAAAAATT TAGTCATGGC ACAAGAATTT TGCAAATGCA AGGACAACTG TATAGACTGG
AAATTTTCTG CCGAAAACTC AGTAACTCAT TCTAGTTTTT AGTTGCAAGT AACATCTTCG AATAATGATG GAATATATAG
TTTCTTGTAC AGCAGTTATA TGATGTTCTT TCTTTCTATT ACACAGATGG TATTCATGTT AGAGTTTATG AAGAAAGGAT
GGACCTCCTG AGGGCATGCC TTGTAGGTGC AGCTGGAACA CCTTATCATG ACAATCTTTT CTTCTTTGAT ATTTTCTTTC
CTCCTGATTA TCCTCATGAG CCACCTGTAA GTTCTTCATT TTTCATTGCT CTTACCTACA TCTTCTATTC CAGATTTTCT
TGCTGCTGAA CAGTAAATAA CCATGTTCAA TTTTTTCCCC CAGTCTGTTC ACTACCATTC CGGTGGCCTC CGTTTGAACC
CAAATTTGTA TGAGTCTGGC AAAGTGTGCC TTAGCCTGCT CAAAACATGG GCAGGAACTG GTAGTGAAGT GTGGGACCCT
GAAAATTCAA CTGTTCTTCA ACTGCTGCTG TCCCTTCAAG CTCTTGTTCT CAATGAAAAA CCTTACTTCA ATGAGGCTGG
CTATGACAAA TTCATGGGGA AAGCAGATGG AGAGAAGAAC TCCATCACTT ACAATGAGAA CGCTTTCCTG CTGTCATGCA
AGTCCATGAC GTACATTTTA CACAAGCCAC CAAAGGTGCG TCTCAGCTCT GGAAATTCTG TACACAGCAA TTTCTGAAAA
AAAGAGCCAT TATGGTGTCC ATACTGTTGT TTTCTTCTCC TAATTTAAAT GATACTCAGA AGTCAAATCT CCTATGGATT
CTCAGGGAAA AAGATAATTT TTGAAAATAC ATTTTTACAC ATCCATGTTT CAGAATGATT GGTATAGTTC AAAGAAGTTT
GGAATCTTGT GAAACCAAAA TCTAAACGCT GTTCAGAATT AAGAATGCTA TAGCTTTAGT TTGTAATGCT TCATGTGAAT
TACTGGATCT CACAAGAGTT TAGTATGTTT AATCTTATAT ATAACCAAGT CAGCTGTAAG AGTCACCCCT TTAAGAAATA
AGATGTGTAT ACTGATAGTT CTTTCTTTTC CTTGATCTAG CATTTCGAGA ATTTTGTCAA GGAGCACTTC ACTTGTTGCG
CGCCGCACAT TCTGGATGCC TGCAAGGCTT ATCTCGGCGG CGATCTTGTT GGACATGCTC GTGACAGCGC CTATATATCG
GATGACGGAT GCAAGAACTC CTCAACCGGT TTCAAGATAA TGCTAGCCAA GCTCTTGCCG AAGCTTGTCA CCACCTTCTC
TGAAGCCGGC ATCCCCTGCA GCCCGTGACT CATGGCATTG TGAGTTTGTG ACACTGGACT ACTGTGTATT TGTGACAAAA
TCGGGACACC AATATATGCT GTGTATGTAC TGTATATGTG CAAGCTTTGT GACTTTGTGT ATCCCAAAAT AAAATGCTGC
CTGGTTTGTA TGATACTTAA CATGGTGATG TCTGTTGTAA CTTGTAAGTG TGGTTGAGGC AGCTGGTGTG GTTGGGTTTG
TGGTCAGTTA CTCAGTTCAC GTGTGTTTTG AGCATGTGAA GTATGT

Locus: Os05g0557700

Loading...

Locus: Os05g0557700

Loading...