Os05t0557700-02

Locus

Os05g0557700

Description

Pi starvation-induced isoform, Regulation of Pi homeostasis

RAP-DB Gene Symbol Synonym(s)

LTN1, PHO2.2

RAP-DB Gene Name Synonym(s)

LEAF TIP NECROSIS 1

CGSNL Gene Symbol

LTN1

CGSNL Gene Name

LEAF TIP NECROSIS 1

Oryzabase Gene Symbol Synonym(s)

LTN1, OsPHO2, PHO2.1, PHO2.2, PHO2, OsUBC35, UBC35

Oryzabase Gene Name Synonym(s)

Leaf tip necrosis1, Phosphate Overaccumulator2, PHOSPHATE2, Ubiquitin-conjugating enzyme 35

Transcript Evidence

Inferred

Protein Evidence

B7F902

Literature

PMID: 27895204

PMID: 24249833

Note

Manual Curation

January 11, 2017

Functional domain (InterPro)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme E2 (IPR000608)

Others

Oryzabase (9255)

Transcript

3830 bp

>Os05t0557700-02 Pi starvation-induced isoform, Regulation of Pi homeostasis
CTGGGGAAGTGAGGAGCTGACCAACCAAAAGGCAGATGCAGATGATGAGATTGTGCTGCA
CTTTGGACGGCGAATTCAGCAGCCGTGTGGATGGATATTCTGCATGCGATCCCGGGATCC
TGTAAAGGGGGATGGATGCACTTTCATGGGGCCTGCTGATCAATGCAAATAGACTTGAAA
GAACATTATATTCTCGTGATCTTATCAAGTGAAGCCATATCTAATGAAAGCTTGTTATAT
TTGTTGCTTTCTTGATGAGATTTGTTGCTTATGACCACTTGTGTCCTCTAATCATCCAAA
GCAAAAAAAATCATTCAGCCGGTCTTTACCTCTCCAGGAATTAACACCTGTGACAAGTTA
TTCCTTGTTTTAGGGCAAATCTCCTTTGGCAATTGCACCTTCCTGTCGATCGATTATCCT
GAGCATATTCCTCTTATTGAGAGAACCCTTCAGCTGGGCAAATCTCCTTTGGCAAAATAC
CTATCTATAGTCTGTCTATTCGGGCAAATCTCCTTTGGCATTTAGCTTAGATTGCTTCCG
GGCAAATCTCCTTTGGCACTACCTTTAGCTTCAGATTGCTCTTTGGGCAAATCTCCTTTG
GCACTAGGTACTCTACTACTATCCGCATTAGATATTTGGATCAAATATCCTCTGGAAGTT
AGTGGTATTACATCATTATTTCCTGCAACTATATATCGTGGTAATTCTCCTTTGGCATTA
GCACTGTACACACATTGGTTCTACCACAATATCGATCTCAGTGAAAGACTGAACACCAGG
AAGTCCAGAACGATTCAAGAAATAATTTTTGGCTGGTGGCCGTTGTATTTTAGCATCTTG
GACAGGAAGCTTTCAGATTCTGATTGTTCAGTCTGGAAGATTGTTTTGTTATTTATCAAC
TCTATACATCAGTGCGCCTATCCTAAGAAGGGCTCGGAAAGATGGATCTATATGCAATTG
ACTCGGACACTGAGTCATACGCTGAAACTAGTGACAGTGAAGAAGACCAAGAAGAATGTG
AACTTACATACTGTGGTCATGCCCAGAACATCTTGTCCAGCTTGGACGAGAGCATTGGAA
AGATCGATAACTTTCTAAGTTTTGAAAGAGGATTTCTGCATGGAGACATAGTTTGCTCTG
CAGCTGACCCATCAGGTCAGCTGGGCCGTGTAGTTGGAGTTGATATGCTTGTTGACTTGG
AAACGAGCTCTGGTGACATAATAAAACATGTCAACAGCAAGAAACTTTCAAGAGTTAGAT
CCTTTGTCTCTGGTGATTGTGTGGTGATGGGGCCATGGATTGGACGGGTGATCAGGGCAT
TTGACCTGGTCACTGTTGTGTTCAGTGATGGGGCAAGGTGTGAAATGCTCTTAAGAGATT
CTGAGGTACTGAAGCCCATTCCTCCAATCCTTTTTGAAGATGCACCTTATTTTTACTATC
CAGGCCAACGTGTGAGAATTGTTCATCCTTCCATTTCTAAGTCGGGTACATGGTTGTGTG
GATCATGGAAAGCTAGTAGAGATGAAGGAGTAGTGTCTCATGTCGACGTTGGGCTGGTAC
ATGTGAACTGGATCACCTCAGTAACAAATGTTTGGGGAGGTCAATCATCAAGTCCTCCAA
ACTTTCAGGACCCAAAGAAGCTCACTTTGCTTTCATGCTTCCCTTATGCCAATTGGCAGT
TGGGTGACTGGTGCACTCTTTCGGATTGCGAGGGAAGTCTCTGGGAAAATTCTGACAAAT
CTTGCTTCATGAGTATGACCTGGAAGTCCAGCTCCGACACTCAAACGGCTATCGGAACTT
ATGGTTCAGATTATTCTCAAACATATGTTGTTGCAAAGACAAAGAGTAGTGTTGATGTTT
TATGGCAAGATGGAAGTACATCTCTTGGTTTAGAACCTCAAAGTTTGGTTCCTGTGAGTA
CTCTTGGTGATCATGATTTTTGGCCTGGGCAATTTATCCTTGAGAAATTGACAGTTGAGG
ATAATGGTAGATGCCAGCGGACTGGGATAGTGACAAGTGTGGATGCACTTGAACGGACTG
TAAAGGTAAAATGGGCTGTTTCAGTTGATAGTGACACTGTCAGTTATGGAGATGGACTCA
CTGAGGAGACTGTGAGTGCTTATGAGCTAGTATTACACCCAGATTTCTCCTTCTTCACTG
GCGAAGTCATTATTAGATCTGCTGTCAACATAGAAAATTCTGAAGCAAATCTTACCAATG
GAACCGTGGCAGTTAGCAGGGAGAGCTTGGATACCTCCTCTGCCTTCTTATCATGTATTG
GCAATGTTCTTGGATACAATGATGAAGGACTTGAAGTCCAATGGGCTAGTGGTGCGATAT
CTAGGGTTCAGCATTTTGAAATTATTGCATTAGATAGGATTCTAGATGATTCTCTAGAAT
CCATGATCGAGGAGCACACTACTGATGATTTGGTAGACATGGCTGAGCAGGAGAAAATGC
ACCTTGAGGATACTAAGAGTGCGCTGGAAGAATCTGCTGGAGACTGTACAGGATCCTTGC
GCAAAGCCACTGCTTTCCTCTTTTCCAAGACAGCATTTAATTTTCTGACAAATGTGGCTT
CTAGTTTGTTTGGTGCTCATGATTCAACATTTTCCAGCTCGGTCAATGCAGATTCTCAGT
ATCAAATTGTGACGACAGCAGAACTGCAGCCATCTGCAGAAGATATCTCTGAAGAGAAAC
AGACCATGGAGCTGATAACACAGTTTGAGAAGCCAACATTAGCTTCAGAAAATGCCATGA
CAAAAGGATTTGATGTTGTGACCGACTGTTCTGATCACCACTTTGTCAAAGAAATTGGTC
ACGAAAATGTCAAAAGAGGTTGGGTGAAGAAGATACAACAGGAATGGTCAATCTTACAAA
ACGATCTGCCAGATGGTATTCATGTTAGAGTTTATGAAGAAAGGATGGACCTCCTGAGGG
CATGCCTTGTAGGTGCAGCTGGAACACCTTATCATGACAATCTTTTCTTCTTTGATATTT
TCTTTCCTCCTGATTATCCTCATGAGCCACCTTCTGTTCACTACCATTCCGGTGGCCTCC
GTTTGAACCCAAATTTGTATGAGTCTGGCAAAGTGTGCCTTAGCCTGCTCAAAACATGGG
CAGGAACTGGTAGTGAAGTGTGGGACCCTGAAAATTCAACTGTTCTTCAACTGCTGCTGT
CCCTTCAAGCTCTTGTTCTCAATGAAAAACCTTACTTCAATGAGGCTGGCTATGACAAAT
TCATGGGGAAAGCAGATGGAGAGAAGAACTCCATCACTTACAATGAGAACGCTTTCCTGC
TGTCATGCAAGTCCATGACGTACATTTTACACAAGCCACCAAAGCATTTCGAGAATTTTG
TCAAGGAGCACTTCACTTGTTGCGCGCCGCACATTCTGGATGCCTGCAAGGCTTATCTCG
GCGGCGATCTTGTTGGACATGCTCGTGACAGCGCCTATATATCGGATGACGGATGCAAGA
ACTCCTCAACCGGTTTCAAGATAATGCTAGCCAAGCTCTTGCCGAAGCTTGTCACCACCT
TCTCTGAAGCCGGCATCCCCTGCAGCCCGTGACTCATGGCATTGTGAGTTTGTGACACTG
GACTACTGTGTATTTGTGACAAAATCGGGACACCAATATATGCTGTGTATGTACTGTATA
TGTGCAAGCTTTGTGACTTTGTGTATCCCAAAATAAAATGCTGCCTGGTTTGTATGATAC
TTAACATGGTGATGTCTGTTGTAACTTGTAAGTGTGGTTGAGGCAGCTGGTGTGGTTGGG
TTTGTGGTCAGTTACTCAGTTCACGTGTGTTTTGAGCATGTGAAGTATGT

CDS

2631 bp

>Os05t0557700-02 Pi starvation-induced isoform, Regulation of Pi homeostasis
ATGGATCTATATGCAATTGACTCGGACACTGAGTCATACGCTGAAACTAGTGACAGTGAA
GAAGACCAAGAAGAATGTGAACTTACATACTGTGGTCATGCCCAGAACATCTTGTCCAGC
TTGGACGAGAGCATTGGAAAGATCGATAACTTTCTAAGTTTTGAAAGAGGATTTCTGCAT
GGAGACATAGTTTGCTCTGCAGCTGACCCATCAGGTCAGCTGGGCCGTGTAGTTGGAGTT
GATATGCTTGTTGACTTGGAAACGAGCTCTGGTGACATAATAAAACATGTCAACAGCAAG
AAACTTTCAAGAGTTAGATCCTTTGTCTCTGGTGATTGTGTGGTGATGGGGCCATGGATT
GGACGGGTGATCAGGGCATTTGACCTGGTCACTGTTGTGTTCAGTGATGGGGCAAGGTGT
GAAATGCTCTTAAGAGATTCTGAGGTACTGAAGCCCATTCCTCCAATCCTTTTTGAAGAT
GCACCTTATTTTTACTATCCAGGCCAACGTGTGAGAATTGTTCATCCTTCCATTTCTAAG
TCGGGTACATGGTTGTGTGGATCATGGAAAGCTAGTAGAGATGAAGGAGTAGTGTCTCAT
GTCGACGTTGGGCTGGTACATGTGAACTGGATCACCTCAGTAACAAATGTTTGGGGAGGT
CAATCATCAAGTCCTCCAAACTTTCAGGACCCAAAGAAGCTCACTTTGCTTTCATGCTTC
CCTTATGCCAATTGGCAGTTGGGTGACTGGTGCACTCTTTCGGATTGCGAGGGAAGTCTC
TGGGAAAATTCTGACAAATCTTGCTTCATGAGTATGACCTGGAAGTCCAGCTCCGACACT
CAAACGGCTATCGGAACTTATGGTTCAGATTATTCTCAAACATATGTTGTTGCAAAGACA
AAGAGTAGTGTTGATGTTTTATGGCAAGATGGAAGTACATCTCTTGGTTTAGAACCTCAA
AGTTTGGTTCCTGTGAGTACTCTTGGTGATCATGATTTTTGGCCTGGGCAATTTATCCTT
GAGAAATTGACAGTTGAGGATAATGGTAGATGCCAGCGGACTGGGATAGTGACAAGTGTG
GATGCACTTGAACGGACTGTAAAGGTAAAATGGGCTGTTTCAGTTGATAGTGACACTGTC
AGTTATGGAGATGGACTCACTGAGGAGACTGTGAGTGCTTATGAGCTAGTATTACACCCA
GATTTCTCCTTCTTCACTGGCGAAGTCATTATTAGATCTGCTGTCAACATAGAAAATTCT
GAAGCAAATCTTACCAATGGAACCGTGGCAGTTAGCAGGGAGAGCTTGGATACCTCCTCT
GCCTTCTTATCATGTATTGGCAATGTTCTTGGATACAATGATGAAGGACTTGAAGTCCAA
TGGGCTAGTGGTGCGATATCTAGGGTTCAGCATTTTGAAATTATTGCATTAGATAGGATT
CTAGATGATTCTCTAGAATCCATGATCGAGGAGCACACTACTGATGATTTGGTAGACATG
GCTGAGCAGGAGAAAATGCACCTTGAGGATACTAAGAGTGCGCTGGAAGAATCTGCTGGA
GACTGTACAGGATCCTTGCGCAAAGCCACTGCTTTCCTCTTTTCCAAGACAGCATTTAAT
TTTCTGACAAATGTGGCTTCTAGTTTGTTTGGTGCTCATGATTCAACATTTTCCAGCTCG
GTCAATGCAGATTCTCAGTATCAAATTGTGACGACAGCAGAACTGCAGCCATCTGCAGAA
GATATCTCTGAAGAGAAACAGACCATGGAGCTGATAACACAGTTTGAGAAGCCAACATTA
GCTTCAGAAAATGCCATGACAAAAGGATTTGATGTTGTGACCGACTGTTCTGATCACCAC
TTTGTCAAAGAAATTGGTCACGAAAATGTCAAAAGAGGTTGGGTGAAGAAGATACAACAG
GAATGGTCAATCTTACAAAACGATCTGCCAGATGGTATTCATGTTAGAGTTTATGAAGAA
AGGATGGACCTCCTGAGGGCATGCCTTGTAGGTGCAGCTGGAACACCTTATCATGACAAT
CTTTTCTTCTTTGATATTTTCTTTCCTCCTGATTATCCTCATGAGCCACCTTCTGTTCAC
TACCATTCCGGTGGCCTCCGTTTGAACCCAAATTTGTATGAGTCTGGCAAAGTGTGCCTT
AGCCTGCTCAAAACATGGGCAGGAACTGGTAGTGAAGTGTGGGACCCTGAAAATTCAACT
GTTCTTCAACTGCTGCTGTCCCTTCAAGCTCTTGTTCTCAATGAAAAACCTTACTTCAAT
GAGGCTGGCTATGACAAATTCATGGGGAAAGCAGATGGAGAGAAGAACTCCATCACTTAC
AATGAGAACGCTTTCCTGCTGTCATGCAAGTCCATGACGTACATTTTACACAAGCCACCA
AAGCATTTCGAGAATTTTGTCAAGGAGCACTTCACTTGTTGCGCGCCGCACATTCTGGAT
GCCTGCAAGGCTTATCTCGGCGGCGATCTTGTTGGACATGCTCGTGACAGCGCCTATATA
TCGGATGACGGATGCAAGAACTCCTCAACCGGTTTCAAGATAATGCTAGCCAAGCTCTTG
CCGAAGCTTGTCACCACCTTCTCTGAAGCCGGCATCCCCTGCAGCCCGTGA

Protein

877 aa

>Os05t0557700-02 Pi starvation-induced isoform, Regulation of Pi homeostasis
MDLYAIDSDTESYAETSDSEEDQEECELTYCGHAQNILSSLDESIGKIDNFLSFERGFLH
GDIVCSAADPSGQLGRVVGVDMLVDLETSSGDIIKHVNSKKLSRVRSFVSGDCVVMGPWI
GRVIRAFDLVTVVFSDGARCEMLLRDSEVLKPIPPILFEDAPYFYYPGQRVRIVHPSISK
SGTWLCGSWKASRDEGVVSHVDVGLVHVNWITSVTNVWGGQSSSPPNFQDPKKLTLLSCF
PYANWQLGDWCTLSDCEGSLWENSDKSCFMSMTWKSSSDTQTAIGTYGSDYSQTYVVAKT
KSSVDVLWQDGSTSLGLEPQSLVPVSTLGDHDFWPGQFILEKLTVEDNGRCQRTGIVTSV
DALERTVKVKWAVSVDSDTVSYGDGLTEETVSAYELVLHPDFSFFTGEVIIRSAVNIENS
EANLTNGTVAVSRESLDTSSAFLSCIGNVLGYNDEGLEVQWASGAISRVQHFEIIALDRI
LDDSLESMIEEHTTDDLVDMAEQEKMHLEDTKSALEESAGDCTGSLRKATAFLFSKTAFN
FLTNVASSLFGAHDSTFSSSVNADSQYQIVTTAELQPSAEDISEEKQTMELITQFEKPTL
ASENAMTKGFDVVTDCSDHHFVKEIGHENVKRGWVKKIQQEWSILQNDLPDGIHVRVYEE
RMDLLRACLVGAAGTPYHDNLFFFDIFFPPDYPHEPPSVHYHSGGLRLNPNLYESGKVCL
SLLKTWAGTGSEVWDPENSTVLQLLLSLQALVLNEKPYFNEAGYDKFMGKADGEKNSITY
NENAFLLSCKSMTYILHKPPKHFENFVKEHFTCCAPHILDACKAYLGGDLVGHARDSAYI
SDDGCKNSSTGFKIMLAKLLPKLVTTFSEAGIPCSP*

5'UTR

chr05:27749377..27749525 (- strand) : 149 bp

chr05:27744971..27745620 (- strand) : 650 bp

chr05:27744738..27744868 (- strand) : 131 bp

chr05:27744608..27744618 (- strand) : 11 bp

CDS

chr05:27743204..27744607 (- strand) : 1404 bp

chr05:27742902..27743033 (- strand) : 132 bp

chr05:27742674..27742817 (- strand) : 144 bp

chr05:27742395..27742601 (- strand) : 207 bp

chr05:27742217..27742280 (- strand) : 64 bp

chr05:27741518..27741657 (- strand) : 140 bp

chr05:27741109..27741420 (- strand) : 312 bp

chr05:27740476..27740703 (- strand) : 228 bp

3'UTR

chr05:27740218..27740475 (- strand) : 258 bp

FASTA

>Os05t0557700-02 class=Sequence position=chr05:27740218..27749525 (- strand)
CTGGGGAAGT GAGGAGCTGA CCAACCAAAA GGCAGATGCA GATGATGAGA TTGTGCTGCA CTTTGGACGG CGAATTCAGC
AGCCGTGTGG ATGGATATTC TGCATGCGAT CCCGGGATCC TGTAAAGGGG GATGGATGCA CTTTCATGGG TATGGAGTGC
AGCCAGCATG CTATTTCTGA ATGAGATGTA GTATTGTCTT TGTTTGTTTT TTTTTCTGTT GTTACAGGAA AATAAATAGC
TTAGAACTTT TACGAAAAAA AAACGTAGTA GTACGTAAAA Gtaaagtaag ggaaaattgg aaccatgcca ttataatttt
gtaaaattta agatatgACT TATGTTTTTT TGGATGAGTA TAAAGGTTTT ATTATGTGAC ATTCTGATTT ATCATGAGTC
TCTAAGCTAT TTACTACACT CAATTCTCTT TTACCATTTT TTCCTGCTAC CAATCATCTA TCTCAAAAAA ATGACAACCT
AAAATGCGTG AAGTCAAACC TTAAATCATC AATAGATGTC AAACATCAAG ATTTGAAATT AATTGGGATA TTTAATGCTT
TCCTTTTCTT TTATAAATAA ACAGCTTGAG AAAATAATGA TAAAACACGT GCATAGGAGA CTGTCCAAAA CATATCCATT
TGAGAACAGA GTTAGTGTGT GTTTAGTAAA TTTGGTAACA CACGCAGATA ATGTTTTTTT GGTTTATGAA ACACAATACA
ATTTGCATGG TATTAATCAA GATGCTTTTG TGCACACAGC AGTACAGCAC ACCGATAGCC AATATTCATG TGTGAAAATC
ATGTCCATAT ATTTGTCTCA AAAGTACATT CATAGTATTG TAAGTTTATT TGAGTTTTCA AATGTTTTGA ATATTTATTA
GTTGTTAAAA CTGTATTTTA AAACCGTACC ATAGTCCAAG TTGATATATT TTTATGATCA TCGGAAATAT GCCACATCTC
AAGACAGTAA CATAAAAAAT TGTAGCCCTG TTCTTTTCGg actattaact ggattattaa aataaactat ttaccccatg
ttttaaagac aatgttttca aaggaaaaac tttctctata gtattacata gaccacttgt tttgtactat taatgaagat
tatttttaaa atttttaaat ttttatataa ttaaatagac aatttgtgat agtaatgtgc tcaataaATC AAACAGGTCT
ATAGAAAAAG AAAAAAAGCC ATGCAAAATA GAATTCCAGT ACAACCATAC CGTCTAaaca aaaggagaaa ctcgacttaa
aaaacttaaa aaacaagaat attatagaag aacctaatat caaataaata gaacgagtga gacttccaat ctggatcggc
tagccatcat ATCTACCTCT ACTCTCAAGG GAAGGAAAAT AACGCCACAA TGGTGCAGCA TCTTTAGTTC CATTAACTTG
ACCACTAATT CACTGTCTTA AATTACTGCT GCAGTTAGGC ACACATCGTT TCACTTCACA CAAGTGGCAG GAGCAAACAG
TGAGAGCATG GGAAGAAAAC GAGTAAAAAA AATTCGATTA CGTTTTCCAA TCCGCACTTG AATTCTTAGG GAAGGAAAAA
AAAGTAAGCA CAAGAAAGAA AGCACAAAGT GGCTGTGAGG AATCCCATTA GCGCAATTAG GAATTAATTT AGGCGGCCGA
ATTAAAGAAA TCAAAAGAAT TTGGAGAGGA GAAGAAGCAC CCCAAAAAGG CGAAGCCTTT GCGCACCATA GAAATCACCA
GGACCCATCG CAAGAGCAGC AGCCTAGCGG AGCACCGAGC AAGAACAAGC AGCAGCAGCA GCAGCAGCAG AAGCAGAAGC
AGTAGAAGAA GAAGCTTTTC TTGCTTTGCT TGCTTTCTCT CTCTCTAGGC TCCATCTCCT CCCTCCACCA CTGCGTCTCG
AAATATCCGG CTTTCTTGTT GTGCGATTTG GTGCGAGGTG GTGGTGATTG CTTCGTCGGC TGTTGATTTC TTCGAGGAAT
TGGAGCTGTG TTGGGGGATT CAGGGGGGCT TCATGGTCGA AGGGCTCGGG GATGGATTGA GGCGTGGGAG AAGAGGAGCT
TAGCTTCCTC TTCTTCTTCG GTGATCGGGT TTGGGGTTCT TGGAATCGCG AGGAGGCGGG ACATGGCGGG AGATTGGGCT
TGTCACAGAC TCAGGTATGG ATTGCATTCT CCTCTCGAAT TTGGTTTCTT TCCGGCTGCC CTCCGCGCAG CCCCTGCCCC
GGCGAGGCTG GCCGGCGGCG ACTGCCACCC CGCCGCCGGT GATGTGCGTG CAAGAATTGC GCTTCAATGG CGAATTTCCT
TGTGTTGTCT CGATTTTGAC CATCACGTTT ACATGGTTAA AAATGGTAGT AGTCTTTAGA AAAAATGGAA GATTCAGGTG
TTCATCGTTA GCTCTTGATA GCAATGCGTC TGATTTTTTT TTCTTTTTTT GGGTCAGTCT TTGAGACTTA GGATTGTTGG
ATTGGGGGAG ATTTGTCATA TATGAGTACT TTGTGGGTGC TACGAATTGT TTTCGCGCCA TTTTTTCTTC TGGTTTTTGG
GAGAGCGTGA TTAGCACGGA AGGTAGTTTG TTGGATTTGA TTAGTTACGT CGGAAAGGTT AAATATTAGC TGCTTATGTC
GACTACGATG TTGAAATGTC TGAGATTTTT CTGTACTGTT GTTTCAATCA AGAAGGCACC CAAACTGGCA ATTCCAAGTA
AAAAAAAACT ATGTTTTATA ACCTACTAGG TTCGTCtaat ttatgcatga ttgatcattt cttgcgttaa taatatgggc
atgattttct gttgatgttt tgttttcgct cgtatgttaa tccttTAGAT ATGGACTTTC AGATGTTTCC TTGTAGTATT
AGTTTTGATT TGACCCCTAT CTGTATGTGG TCTTTTAATA GTAAAATCTA ACCATATAAA TGTGCAGATA TTTGGAGTAA
AATTCTTCTA TTTACATTTC TTTCAACGAC TGTTATCTGA ATTTTTTTGC GTGCAGTTTG ATTTTATACT CTCTTTTGCA
AGTAACGTTA ATAATTTTTT TAATCTTAAT AGTTTTTTGT GTCAGTTTAA AGCCTTAAGC TGGTTTGTAA GTACCAATGA
TTTAGAATTT TAGATACTTT TACTTTCGAT TGACTGTTAC GTAGCAGGAT CATACTGCAG AATGCTCATC TGTGAGCTTT
CTATAGGCTC TTTACTCTCT CTTTTAACAT CTGCTATGCT GTATTGCAAA CTAGCTATTC ATTATGTTTC CTGAATAATG
AAAATGTGTG TCTGCCGGTC TGCCCCTGTT TGGATAAGAA AATTTCAAGT ACTGGCATAT AAAGGAAAAT GGACTATTTC
AGGCAAATAT TCATTTTTGC TTGTTATGAG ACTTATATTA TTTTACTTTA GATACCTTTA CTATCAACAA GTGGTGGTTG
ATTCATATCC TACCCTTTTT TGTGTGTAGA GCTGTAAATG CTTAACCATG AGCATTGTAG TATGTACATG AGTTAGTTCC
TTGTAGAACT CAAATTATCG TCAAATCATC ATACTAAAGT ATCCGTACAA GATTCATTGT ACAAAACCTT TTTTTTTGGT
AAAATTTTTT TCGATAATGT TTTGGTAAAA TTTGCATCCT ATCAACAAGC AACATGAAAC CATGCATATA CATATATGTA
GAGTTGTAAA TGATCCTTTT TTTTTATATC CTCAAAAAGA CCAAAACGCA CGCATATGTC CAGCACAAAC ATTTGTAGCA
ACATATAAAT CTTTATGAGG TTGATCTTTG TGCCTAATAA TGCCTTTTGA TGAGAGTGTT CTCTAAAGCA TCTAAGATAC
TAATATTTTT CTCAATTTGG ATTGTCGTGA CCAATTGGAC TGAAGTTCTC ACCACATGTT TGCAGGGCCT GCTGATCAAT
GCAAATAGAC TTGAAAGAAC ATTATATTCT CGTGATCTTA TCAAGTGAAG CCATATCTAA TGAAAGCTTG TTATATTTGT
TGCTTTCTTG ATGAGATTTG TTGCTTATGA CCACTTGTGT CCTCTAATCA TCCAAAGCAA AAAAAATCAT TCAGCCGGTC
TTTACCTCTC CAGGAATTAA CACCTGTGAC AAGTTATTCC TTGTTTTAGG GCAAATCTCC TTTGGCAATT GCACCTTCCT
GTCGATCGAT TATCCTGAGC ATATTCCTCT TATTGAGAGA ACCCTTCAGC TGGGCAAATC TCCTTTGGCA AAATACCTAT
CTATAGTCTG TCTATTCGGG CAAATCTCCT TTGGCATTTA GCTTAGATTG CTTCCGGGCA AATCTCCTTT GGCACTACCT
TTAGCTTCAG ATTGCTCTTT GGGCAAATCT CCTTTGGCAC TAGGTACTCT ACTACTATCC GCATTAGATA TTTGGATCAA
ATATCCTCTG GAAGTTAGTG GTATTACATC ATTATTTCCT GCAACTATAT ATCGTGGTAA TTCTCCTTTG GCATTAGCAC
TGTACACACA TTGGTTCTAC CACAATATCG ATCTCAGTGA AAGACTGAAC ACCAGGAAGT CCAGAACGAT TCAAGGTAAT
TTGTCCTCTT TTATGGTGTA TATTTTTTAT GTGAGCCGTC ATTTTCTATA ATATTTATTC ACTTACAAAA GCTTTCCTAT
TTTGACTCAA TTTTCAGAAA TAATTTTTGG CTGGTGGCCG TTGTATTTTA GCATCTTGGA CAGGAAGCTT TCAGATTCTG
ATTGTTCAGT CTGGAAGATT GTTTTGTTAT TTATCAACTC TATACATCAG TGCGCCTATC CTAAGAAGGT GAGCATGTAG
TTAATAGTAT ATTTCCTTTA AATATTTCTG TGTCTATTCC ATTATCTAAA AAATATATAT TTCTGTGTCT GATTCCATGT
GAAAAATGAC AACGTACTTT GTTTTAGGGC TCGGAAAGAT GGATCTATAT GCAATTGACT CGGACACTGA GTCATACGCT
GAAACTAGTG ACAGTGAAGA AGACCAAGAA GAATGTGAAC TTACATACTG TGGTCATGCC CAGAACATCT TGTCCAGCTT
GGACGAGAGC ATTGGAAAGA TCGATAACTT TCTAAGTTTT GAAAGAGGAT TTCTGCATGG AGACATAGTT TGCTCTGCAG
CTGACCCATC AGGTCAGCTG GGCCGTGTAG TTGGAGTTGA TATGCTTGTT GACTTGGAAA CGAGCTCTGG TGACATAATA
AAACATGTCA ACAGCAAGAA ACTTTCAAGA GTTAGATCCT TTGTCTCTGG TGATTGTGTG GTGATGGGGC CATGGATTGG
ACGGGTGATC AGGGCATTTG ACCTGGTCAC TGTTGTGTTC AGTGATGGGG CAAGGTGTGA AATGCTCTTA AGAGATTCTG
AGGTACTGAA GCCCATTCCT CCAATCCTTT TTGAAGATGC ACCTTATTTT TACTATCCAG GCCAACGTGT GAGAATTGTT
CATCCTTCCA TTTCTAAGTC GGGTACATGG TTGTGTGGAT CATGGAAAGC TAGTAGAGAT GAAGGAGTAG TGTCTCATGT
CGACGTTGGG CTGGTACATG TGAACTGGAT CACCTCAGTA ACAAATGTTT GGGGAGGTCA ATCATCAAGT CCTCCAAACT
TTCAGGACCC AAAGAAGCTC ACTTTGCTTT CATGCTTCCC TTATGCCAAT TGGCAGTTGG GTGACTGGTG CACTCTTTCG
GATTGCGAGG GAAGTCTCTG GGAAAATTCT GACAAATCTT GCTTCATGAG TATGACCTGG AAGTCCAGCT CCGACACTCA
AACGGCTATC GGAACTTATG GTTCAGATTA TTCTCAAACA TATGTTGTTG CAAAGACAAA GAGTAGTGTT GATGTTTTAT
GGCAAGATGG AAGTACATCT CTTGGTTTAG AACCTCAAAG TTTGGTTCCT GTGAGTACTC TTGGTGATCA TGATTTTTGG
CCTGGGCAAT TTATCCTTGA GAAATTGACA GTTGAGGATA ATGGTAGATG CCAGCGGACT GGGATAGTGA CAAGTGTGGA
TGCACTTGAA CGGACTGTAA AGGTAAAATG GGCTGTTTCA GTTGATAGTG ACACTGTCAG TTATGGAGAT GGACTCACTG
AGGAGACTGT GAGTGCTTAT GAGCTAGTAT TACACCCAGA TTTCTCCTTC TTCACTGGCG AAGTCATTAT TAGATCTGCT
GTCAACATAG AAAATTCTGA AGCAAATCTT ACCAATGGAA CCGTGGCAGT TAGCAGGGAG AGCTTGGATA CCTCCTCTGC
CTTCTTATCA TGTATTGGCA ATGTTCTTGG ATACAATGAT GAAGGACTTG AAGTCCAATG GGCTAGTGGT GCGATATCTA
GGGTAAGCTT AACTTTGAGA AACTTTCTTC TCTTTTTTTT GTTGCTTTGA TTTATTTTAT TTACAGAAGT GTTGCTTTAC
TTTATACCAG TTTTATTTCC AAACTTTGAT GAAACATGGA TCGGTCCCTG GTCAGACTAA TGATAACATA ACTTATCTTG
TACAAATTTC AGGTTCAGCA TTTTGAAATT ATTGCATTAG ATAGGATTCT AGATGATTCT CTAGAATCCA TGATCGAGGA
GCACACTACT GATGATTTGG TAGACATGGC TGAGCAGGAG AAAATGCACC TTGAGGATAC TAAGGTCCGC TTCTGTCTAC
AAATTCCATT GTACGGTTAT TAAACTTATG GGTTGAAATT TCATCGATGA TTTATCATTT TCATTCAGAG TGCGCTGGAA
GAATCTGCTG GAGACTGTAC AGGATCCTTG CGCAAAGCCA CTGCTTTCCT CTTTTCCAAG ACAGCATTTA ATTTTCTGAC
AAATGTGGCT TCTAGTTTGT TTGGTGCTCA TGATTCAACA TTTTCCAGCT CGGTAAGTTC TATTTCTCTC TAGATGATGC
AAGCTAAATT TTTATAGAAT TCTGAGACAA CGGCATTGTT TCAGGTCAAT GCAGATTCTC AGTATCAAAT TGTGACGACA
GCAGAACTGC AGCCATCTGC AGAAGATATC TCTGAAGAGA AACAGACCAT GGAGCTGATA ACACAGTTTG AGAAGCCAAC
ATTAGCTTCA GAAAATGCCA TGACAAAAGG ATTTGATGTT GTGACCGACT GTTCTGATCA CCACTTTGTC AAAGAAATTG
GTCACGAAAA TGTAATGGTT TACTTAGTGC AACTTTCTTT CTTTATTTTT CTAGCAAATT GCAATGCCTA TTAATATTGG
AGTATATGCA ATTCAATGTC ATAATAATTA TTTCTGTTCT TCTAGGTCAA AAGAGGTTGG GTGAAGAAGA TACAACAGGA
ATGGTCAATC TTACAAAACG ATCTGCCAGG TTTGTTTTCT TCTCTCATTG TATAGTTTAT TCAGTTGCAA CTCTTCATTA
AGTCTTGTTG TTAAATTTGA TATTTTGGCA TATGTTTATT TTAATTTTAA TTTCTGAGCT AGCATGGCTT AATACTGACG
ATCCTTATAT CCCACTATTT TTTTACTTGA TATGACATGT ATATACTTGT GGTCAAAGAT AGGAATAAGT TAAAATTTTC
TACATTCCAC AGGATAGCAT AGCATGTGAG AATCCCAGAA ACAATCAATC TCGGTAGCAA GTATGCAAGG AGATGAGTGG
AGTTATAAAG GCAAAATTTA TTTTAGTTTT ATCATGTATG TGACCTGTTA TTATTTAATA AATCATTACT TGTTAATCAG
TGGGAAAAAA TTTAGTCATG GCACAAGAAT TTTGCAAATG CAAGGACAAC TGTATAGACT GGAAATTTTC TGCCGAAAAC
TCAGTAACTC ATTCTAGTTT TTAGTTGCAA GTAACATCTT CGAATAATGA TGGAATATAT AGTTTCTTGT ACAGCAGTTA
TATGATGTTC TTTCTTTCTA TTACACAGAT GGTATTCATG TTAGAGTTTA TGAAGAAAGG ATGGACCTCC TGAGGGCATG
CCTTGTAGGT GCAGCTGGAA CACCTTATCA TGACAATCTT TTCTTCTTTG ATATTTTCTT TCCTCCTGAT TATCCTCATG
AGCCACCTGT AAGTTCTTCA TTTTTCATTG CTCTTACCTA CATCTTCTAT TCCAGATTTT CTTGCTGCTG AACAGTAAAT
AACCATGTTC AATTTTTTCC CCCAGTCTGT TCACTACCAT TCCGGTGGCC TCCGTTTGAA CCCAAATTTG TATGAGTCTG
GCAAAGTGTG CCTTAGCCTG CTCAAAACAT GGGCAGGAAC TGGTAGTGAA GTGTGGGACC CTGAAAATTC AACTGTTCTT
CAACTGCTGC TGTCCCTTCA AGCTCTTGTT CTCAATGAAA AACCTTACTT CAATGAGGCT GGCTATGACA AATTCATGGG
GAAAGCAGAT GGAGAGAAGA ACTCCATCAC TTACAATGAG AACGCTTTCC TGCTGTCATG CAAGTCCATG ACGTACATTT
TACACAAGCC ACCAAAGGTG CGTCTCAGCT CTGGAAATTC TGTACACAGC AATTTCTGAA AAAAAGAGCC ATTATGGTGT
CCATACTGTT GTTTTCTTCT CCTAATTTAA ATGATACTCA GAAGTCAAAT CTCCTATGGA TTCTCAGGGA AAAAGATAAT
TTTTGAAAAT ACATTTTTAC ACATCCATGT TTCAGAATGA TTGGTATAGT TCAAAGAAGT TTGGAATCTT GTGAAACCAA
AATCTAAACG CTGTTCAGAA TTAAGAATGC TATAGCTTTA GTTTGTAATG CTTCATGTGA ATTACTGGAT CTCACAAGAG
TTTAGTATGT TTAATCTTAT ATATAACCAA GTCAGCTGTA AGAGTCACCC CTTTAAGAAA TAAGATGTGT ATACTGATAG
TTCTTTCTTT TCCTTGATCT AGCATTTCGA GAATTTTGTC AAGGAGCACT TCACTTGTTG CGCGCCGCAC ATTCTGGATG
CCTGCAAGGC TTATCTCGGC GGCGATCTTG TTGGACATGC TCGTGACAGC GCCTATATAT CGGATGACGG ATGCAAGAAC
TCCTCAACCG GTTTCAAGAT AATGCTAGCC AAGCTCTTGC CGAAGCTTGT CACCACCTTC TCTGAAGCCG GCATCCCCTG
CAGCCCGTGA CTCATGGCAT TGTGAGTTTG TGACACTGGA CTACTGTGTA TTTGTGACAA AATCGGGACA CCAATATATG
CTGTGTATGT ACTGTATATG TGCAAGCTTT GTGACTTTGT GTATCCCAAA ATAAAATGCT GCCTGGTTTG TATGATACTT
AACATGGTGA TGTCTGTTGT AACTTGTAAG TGTGGTTGAG GCAGCTGGTG TGGTTGGGTT TGTGGTCAGT TACTCAGTTC
ACGTGTGTTT TGAGCATGTG AAGTATGT

Locus: Os05g0557700

Loading...

Locus: Os05g0557700

Loading...