Os05t0559400-01

Locus

Os05g0559400

Description

Similar to IAA11 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA19

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA19

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 19, Auxin-responsive Aux/IAA gene family member 19

Transcript Evidence

AK106181 (DDBJ, Best hit)

Protein Evidence

Q6AT33 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

001-208-D03 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0559400-01)

Others

Oryzabase (10908)

Transcript

1261 bp

>Os05t0559400-01 Similar to IAA11 (Fragment).
ACTTCTCCCTTTAAGCTCTCTCCTCCCCTTCTCCAAGAGAAGAACAAAAAGACATTCGCT
TTCGCCTCTTCTCCCCCTCTCCTCTCCTCTCCTCTCCTCTCTGCGTGTGCATCTCTCGAT
TCCGATGCCGCCGCCGCTCGAAGCGCGAGACTACATCGGGCTCGCGGCGTCCCCGGCCTC
GTCCTCCTCCTCCTGCTGCGCGTCGACCCCCGTCGCCGAGGTCGTCGGGGCGCACCTCGC
GCTCCGCCTCGGCCTCCCGGGGTCGGAGTCGCCCGCCCGCGCTGAGGCGGAGGCTGTCGT
CGTCGACGCCGCGCTCACGCTCGGCCCTGCTCCTCCTCCCAGGGGCGGCGCCAAGCGCGG
GTTCGTCGACTCCCTCGACCGATCCGAGGGCCGTCGTGCTGCTGCCACCGCCGGTGATGA
TGAGAGGGGCGTGAGGGAGGAGGAGGAGGAGGAGAAGGGGTTGGGGGAAGCTGCTGCTGG
AGCTCCGCGAGCTGCCAAGGCACAAGTTGTTGGATGGCCACCTGTGCGAAGCTACCGGAA
GAATACATTGGCCGCCAGTGCCACAAAGACAAAGGGGGAAGACCAAGGCAAAAGTGAGGT
AGGATGTTGCTATGTTAAGGTTAGCATGGATGGAGCCCCATACCTTAGGAAGGTTGACCT
CAAGACCTATTCAAGCTATGAAGATCTTTCACTTGCTCTTGAGAAGATGTTCAGCTGCTT
TATCACTGGTAGGAGCAGTTCACATAAAACATCAAAAAGAGACAGGCTGACTGATGGTTC
TAGGGCTGATGCCCTTAAGGACCAAGAGTATGTTCTTACCTATGAAGACAAGGATGCTGA
CTGGATGCTTGTTGGTGATCTTCCTTGGGActtgtttactactagttgtcggaaactgcg
gatcatgagaggttcagatgctgctggaatggCTCCGAGATCACTGGAACAGACAGGTCA
GAACAAATAGTTGCCCGAGCTTTCATCATCTGGACAGCAAATGTGTGGACCAAGTTTGCT
GTAGCAAGTTTCCGCTGAGGGGTGCAGTGTTTTACCTGAAGTATCTCCGCTATTAGTTTA
TTTACGTGTGTAGTGAAATCTGTGGCGTATTGTAAAACAGCCATTTTGCCTACGAGGTTG
TCTTGTGTCAATCTGTAGATGGTCGATTTTGTCTTTGAAAGATCAAGTCAGGCTGCTTAA
TGCTTCCTGTGTGATACTTTCATCAATTCTCTCATATATATATTATCTGGAGTTGCACTT
G

CDS

846 bp

>Os05t0559400-01 Similar to IAA11 (Fragment).
ATGCCGCCGCCGCTCGAAGCGCGAGACTACATCGGGCTCGCGGCGTCCCCGGCCTCGTCC
TCCTCCTCCTGCTGCGCGTCGACCCCCGTCGCCGAGGTCGTCGGGGCGCACCTCGCGCTC
CGCCTCGGCCTCCCGGGGTCGGAGTCGCCCGCCCGCGCTGAGGCGGAGGCTGTCGTCGTC
GACGCCGCGCTCACGCTCGGCCCTGCTCCTCCTCCCAGGGGCGGCGCCAAGCGCGGGTTC
GTCGACTCCCTCGACCGATCCGAGGGCCGTCGTGCTGCTGCCACCGCCGGTGATGATGAG
AGGGGCGTGAGGGAGGAGGAGGAGGAGGAGAAGGGGTTGGGGGAAGCTGCTGCTGGAGCT
CCGCGAGCTGCCAAGGCACAAGTTGTTGGATGGCCACCTGTGCGAAGCTACCGGAAGAAT
ACATTGGCCGCCAGTGCCACAAAGACAAAGGGGGAAGACCAAGGCAAAAGTGAGGTAGGA
TGTTGCTATGTTAAGGTTAGCATGGATGGAGCCCCATACCTTAGGAAGGTTGACCTCAAG
ACCTATTCAAGCTATGAAGATCTTTCACTTGCTCTTGAGAAGATGTTCAGCTGCTTTATC
ACTGGTAGGAGCAGTTCACATAAAACATCAAAAAGAGACAGGCTGACTGATGGTTCTAGG
GCTGATGCCCTTAAGGACCAAGAGTATGTTCTTACCTATGAAGACAAGGATGCTGACTGG
ATGCTTGTTGGTGATCTTCCTTGGGActtgtttactactagttgtcggaaactgcggatc
atgagaggttcagatgctgctggaatggCTCCGAGATCACTGGAACAGACAGGTCAGAAC
AAATAG

Protein

282 aa

>Os05t0559400-01 Similar to IAA11 (Fragment).
MPPPLEARDYIGLAASPASSSSSCCASTPVAEVVGAHLALRLGLPGSESPARAEAEAVVV
DAALTLGPAPPPRGGAKRGFVDSLDRSEGRRAAATAGDDERGVREEEEEEKGLGEAAAGA
PRAAKAQVVGWPPVRSYRKNTLAASATKTKGEDQGKSEVGCCYVKVSMDGAPYLRKVDLK
TYSSYEDLSLALEKMFSCFITGRSSSHKTSKRDRLTDGSRADALKDQEYVLTYEDKDADW
MLVGDLPWDLFTTSCRKLRIMRGSDAAGMAPRSLEQTGQNK*

5'UTR

chr05:27850268..27850391 (- strand) : 124 bp

CDS

chr05:27849894..27850267 (- strand) : 374 bp

chr05:27849005..27849234 (- strand) : 230 bp

chr05:27848059..27848200 (- strand) : 142 bp

chr05:27847291..27847352 (- strand) : 62 bp

chr05:27846491..27846528 (- strand) : 38 bp

3'UTR

chr05:27846200..27846490 (- strand) : 291 bp

FASTA

>Os05t0559400-01 class=Sequence position=chr05:27846200..27850391 (- strand)
ACTTCTCCCT TTAAGCTCTC TCCTCCCCTT CTCCAAGAGA AGAACAAAAA GACATTCGCT TTCGCCTCTT CTCCCCCTCT
CCTCTCCTCT CCTCTCCTCT CTGCGTGTGC ATCTCTCGAT TCCGATGCCG CCGCCGCTCG AAGCGCGAGA CTACATCGGG
CTCGCGGCGT CCCCGGCCTC GTCCTCCTCC TCCTGCTGCG CGTCGACCCC CGTCGCCGAG GTCGTCGGGG CGCACCTCGC
GCTCCGCCTC GGCCTCCCGG GGTCGGAGTC GCCCGCCCGC GCTGAGGCGG AGGCTGTCGT CGTCGACGCC GCGCTCACGC
TCGGCCCTGC TCCTCCTCCC AGGGGCGGCG CCAAGCGCGG GTTCGTCGAC TCCCTCGACC GATCCGAGGG CCGTCGTGCT
GCTGCCACCG CCGGTGATGA TGAGAGGGGC GTGAGGGAGG AGGAGGAGGA GGAGAAGGGG TTGGGGGAAG CTGCTGCTGG
AGCTCCGCGA GCTGCCAAGT AAGCATGCGT GCTCCTGTTT GGTTTTGAGT TGGTTTGATT TAGAGCTCTC TGGGCTAATT
TATAGCTTGT TAAATATAGG AATATTTGAT TTGCTGGTTT GATGGCGCTT CATTAGTTCT AGATGTTAAA ATAGGAGCAG
TAGTGACCAA TTAAATTGAT ACTAGTTCTC ATGGTTATTT TCTCTGGAAT GTAGAAATGA TCAAatacat agtaatagta
tattttgctg tgctaattgt tagtcaacag ttataaagtt tgaatcttga gacacacgtg cgcTTTATGT TCATCATTGG
AGGGGGTACT TGCTAAACTG AACACGGAAG AAAAAGATTC CTGGTAAAAC CGCCACCTGA CTGGAAAAAG CTCGAGCTTT
GTTGAAAAAT TGTCACATAA CCAGGTGTTG TGACCAAATG GTGCTGCCTC TCTTGATTTT CCACCTGCAC TGGTACTGTT
GCTCAGGTGA TATAACTAAA CTGCTTAGGA GTTAGGATAG AGATATGTAA TAAACTACTT GTAACCAGGT CTTGAAGGGT
TCAAGGGACC TGAGTTCAAT TTTTTCATGA AGTTGGTGGT TAGTTGAAGA TCATATGTCA CTAGATATAT GTTTTGTTCT
GAAACATTTA GTCTGATAGT ATGTGTTTAT GCGCTAGGGC ACAAGTTGTT GGATGGCCAC CTGTGCGAAG CTACCGGAAG
AATACATTGG CCGCCAGTGC CACAAAGACA AAGGGGGAAG ACCAAGGCAA AAGTGAGGTA GGATGTTGCT ATGTTAAGGT
TAGCATGGAT GGAGCCCCAT ACCTTAGGAA GGTTGACCTC AAGACCTATT CAAGCTATGA AGATCTTTCA CTTGCTCTTG
AGAAGATGTT CAGCTGCTTT ATCACTGGTG AGTATTTCTG TTTTCTGTTT GTTTCTTTGT AGATTTGTTC AATTTGCTTT
CTTTTGCATG TAGCTTTAGA TGCCAATTAG TTTGGTTGTG TACTTGTGTC ATTGCGTGCA TCCTTATTTG GTACATAGAC
TGGAAGTAAG TTATACTTCC ATTATCCAAA AAAAATCAAT TTGTGTGCAT TAGTTTGATG AAATAGAACG ATATTTTGTG
TGCATTAAAT ATGTAGTTAA GACAGATATT CTGTGTAATG AAATATTCCA TTATCTAATA AAAAGACTGA TATAATCCAT
GTCTTTTTTC CTCGCTTTTG GAAGATCTTC GGAGTTCTAA AATAATGTAA TGATAGAAGG GGAAGCTGAT GCATGGCTAC
TAGTGGATTT GGTCTAGCTG GACTACAGTT GCCAGATTAT TTTGACTAAG CATATTTCTT CATCTGAGTC AAGTAGCCAA
GAACTAACCG TAGAACAATA AGTGCTGTGC TTAGATGCTA AACCCTGTTT TCCTATGCGG CGGTGAAACA ATAGAAAAGT
GATAATGAAG TCCATTAGTA AAAAGAGAAC TCTTGTGGTA ACTATGTTTG TTTAAAATTT GATTTGCTTA CTTTACCGAT
ATTTTGACAC AGTTATTGTG TTTGCACTGT ATGTTTGTGT AAGTTGAAAT AGCATTTCCA TTTTTACTAA GCCCATGTAT
ACCTTGATTT TGGGACGCTC GTGTGTATTC AACTACAAAA GTGCTTTCTA TTGTCTGTAT TTTACATATA TCCAGGAAAC
ATATTAATGG TTGACTTGTT TTGCAATACA GGTAGGAGCA GTTCACATAA AACATCAAAA AGAGACAGGC TGACTGATGG
TTCTAGGGCT GATGCCCTTA AGGACCAAGA GTATGTTCTT ACCTATGAAG ACAAGGATGC TGACTGGATG CTTGTTGGTG
ATCTTCCTTG GGAGTGAGTT CTAACTTTGT GATCATGCAT CTTATCTTAT TTAAATTGTG ATGGTTTTTA TGATTTTCTC
TTGCGGCATT CTTGTCTTGC ATAGAATACG TTCAGACATT CAGATAACAG TATTCTTCTG CTGTTGATGC AGTAACTGTA
GTTAGGAGAT CTTGATAGTG TATGATGGGA GCTTGATTTA CCAATAATGT TACTTCTTCT AGTGGTTTGA ACTCGATAAC
ACATTACTAA CACTTATGAT GATATTTGGA GTCAACTAAA ATTATGCAAA CCAATGCCCT GTAACTTGCT GAAAAGTTAG
ATGGACTCGT GTAAAATGTT TATTCAAGTC TCTCTCTCTA GAGTTCTCTG AGTACTCCAG TTTCACTCTT CAGTATGAAT
TAGAATTATA AATCCTTTCT GAATTTTGAT TGTTCTCTTT GAGAAAGTTC GAGTTCTATG GGCAATGTTT TTTCATACTT
TTAGTTGGCA CATTTCAAGA GTTTGTACAG TCTACCAATA AAAATTTATC TTGTATAAAA ATGTGTCACT CCCACCCCTC
AGTACTACAC TGTTTCGTAT ATCAACAGAC AATTGTTCAC AAGTTCAATA TGACCTATGA ATTGTTTGAC TGAGCTACCA
TGTTTTTTTT TCCCGATGTT tcagcagtta tttacaatca ttcttggtta ccatctaata tcttgtacat cattttcagc
ttgtttacta ctagttgtcg gaaactgcgg atcatgagag gttcagatgc tgctggaatg ggtatgtGCA ATATCTGTAG
CACTTGGCCA TACTTTGATT TCAAGGTTTC ATGAGACAAA TTAATCATTC AAGCATTCAC ATGCTTTTCC ATTGAGATGC
GCATTATGCT AATATTGGTG ATAACTTGGA CCTTGCTGGT TAGTTGTACC TGTACAATTA CAAATAAATT ATGTCACATG
TTTAAATTTT TCATTGATGT TTATTGGCAT AGCCTCAGAT AACTTGAGTA ACGGTAACTC GGTAAGACAT AAGACATGAA
AAGGGTGAGG ATATCGCATG AAATTTACCA GTCCTACAAT TGAAGACACA AGTCTGATTG TATCCTTGAT TTTGGAATAA
AGCAAGTGAA CAAATACAAC ATGTTCTTTG GCCTTTGGAG GTATATTCCT AAAATACAGA ATACAAATAT AACTGCACGC
CTTATGCATC GTCTATTGCA ACAAATCACT AGTGATTTGG CTGAAGGTGG ATCAGTCCAC ATTGCTAAAA TGCTAAAAGC
CTAAAACTAT TTTGACTTAA TCTGGATGAC CTGGAACTCT GCAACTAAGT ATTACAGATC TGCCTTTATA TTTAGAGGCA
TATCTAAACA TCATTTTCCA TTGGTATCTG ATATTTGGGA ACACTGGTGG ATGCTCTCTC ATTAGCTAGC AGCATTTTTC
TTATGGGGTT TTGACCGTAA CTTCTTGATA ACTTAATGCA TCGATTCCTT AACGAATATG TATTGATTTG TCCTTGTCTG
AAGTATCTTC TGTGTCCCTG CAGCTCCGAG ATCACTGGAA CAGACAGGTC AGAACAAATA GTTGCCCGAG CTTTCATCAT
CTGGACAGCA AATGTGTGGA CCAAGTTTGC TGTAGCAAGT TTCCGCTGAG GGGTGCAGTG TTTTACCTGA AGTATCTCCG
CTATTAGTTT ATTTACGTGT GTAGTGAAAT CTGTGGCGTA TTGTAAAACA GCCATTTTGC CTACGAGGTT GTCTTGTGTC
AATCTGTAGA TGGTCGATTT TGTCTTTGAA AGATCAAGTC AGGCTGCTTA ATGCTTCCTG TGTGATACTT TCATCAATTC
TCTCATATAT ATATTATCTG GAGTTGCACT TG

Locus: Os05g0559400

Loading...

Locus: Os05g0559400

Loading...