Os05t0559400-02

Locus

Os05g0559400

Description

Similar to IAA11 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA19

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA19

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 19, Auxin-responsive Aux/IAA gene family member 19

Transcript Evidence

AK061439 (DDBJ, Best hit)

AK099253 (DDBJ, Best hit)

AK109363 (DDBJ, Best hit)

Protein Evidence

Q6AT33 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

006-307-B11 (Online Clone Ordering)

J013168H04 (Online Clone Ordering)

006-206-E12 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0559400-02)

Others

Oryzabase (10908)

Transcript

1222 bp

>Os05t0559400-02 Similar to IAA11 (Fragment).
AAGAACAAAAAGACATTCGCTTTCGCCTCTTCTCCCCCTCTCCTCTCCTCTCCTCTCCTC
TCTGCGTGTGCATCTCTCGATTCCGATGCCGCCGCCGCTCGAAGCGCGAGACTACATCGG
GCTCGCGGCGTCCCCGGCCTCGTCCTCCTCCTCCTGCTGCGCGTCGACCCCCGTCGCCGA
GGTCGTCGGGGCGCACCTCGCGCTCCGCCTCGGCCTCCCGGGGTCGGAGTCGCCCGCCCG
CGCTGAGGCGGAGGCTGTCGTCGTCGACGCCGCGCTCACGCTCGGCCCTGCTCCTCCTCC
CAGGGGCGGCGCCAAGCGCGGGTTCGTCGACTCCCTCGACCGATCCGAGGGCCGTCGTGC
TGCTGCCACCGCCGGTGATGATGAGAGGGGCGTGAGGGAGGAGGAGGAGGAGGAGAAGGG
GTTGGGGGAAGCTGCTGCTGGAGCTCCGCGAGCTGCCAAGGCACAAGTTGTTGGATGGCC
ACCTGTGCGAAGCTACCGGAAGAATACATTGGCCGCCAGTGCCACAAAGACAAAGGGGGA
AGACCAAGGCAAAAGTGAGGTAGGATGTTGCTATGTTAAGGTTAGCATGGATGGAGCCCC
ATACCTTAGGAAGGTTGACCTCAAGACCTATTCAAGCTATGAAGATCTTTCACTTGCTCT
TGAGAAGATGTTCAGCTGCTTTATCACTGGTAGGAGCAGTTCACATAAAACATCAAAAAG
AGACAGGCTGACTGATGGTTCTAGGGCTGATGCCCTTAAGGACCAAGAGTATGTTCTTAC
CTATGAAGACAAGGATGCTGACTGGATGCTTGTTGGTGATCTTCCTTGGGActtgtttac
tactagttgtcggaaactgcggatcatgagaggttcagatgctgctggaatggCTCCGAG
ATCACTGGAACAGACAGGTCAGAACAAATAGTTGCCCGAGCTTTCATCATCTGGACAGCA
AATGTGTGGACCAAGTTTGCTGTAGCAAGTTTCCGCTGAGGGGTGCAGTGTTTTACCTGA
AGTATCTCCGCTATTAGTTTATTTACGTGTGTAGTGAAATCTGTGGCGTATTGTAAAACA
GCCATTTTGCCTACGAGGTTGTCTTGTGTCAATCTGTAGATGGTCGATTTTGTCTTTGAA
AGATCAAGTCAGGCTGCTTAATGCTTCCTGTGTGATACTTTCATCAATTCTCTCATATAT
ATATTATCTGGAGTTGCACTTG

CDS

846 bp

>Os05t0559400-02 Similar to IAA11 (Fragment).
ATGCCGCCGCCGCTCGAAGCGCGAGACTACATCGGGCTCGCGGCGTCCCCGGCCTCGTCC
TCCTCCTCCTGCTGCGCGTCGACCCCCGTCGCCGAGGTCGTCGGGGCGCACCTCGCGCTC
CGCCTCGGCCTCCCGGGGTCGGAGTCGCCCGCCCGCGCTGAGGCGGAGGCTGTCGTCGTC
GACGCCGCGCTCACGCTCGGCCCTGCTCCTCCTCCCAGGGGCGGCGCCAAGCGCGGGTTC
GTCGACTCCCTCGACCGATCCGAGGGCCGTCGTGCTGCTGCCACCGCCGGTGATGATGAG
AGGGGCGTGAGGGAGGAGGAGGAGGAGGAGAAGGGGTTGGGGGAAGCTGCTGCTGGAGCT
CCGCGAGCTGCCAAGGCACAAGTTGTTGGATGGCCACCTGTGCGAAGCTACCGGAAGAAT
ACATTGGCCGCCAGTGCCACAAAGACAAAGGGGGAAGACCAAGGCAAAAGTGAGGTAGGA
TGTTGCTATGTTAAGGTTAGCATGGATGGAGCCCCATACCTTAGGAAGGTTGACCTCAAG
ACCTATTCAAGCTATGAAGATCTTTCACTTGCTCTTGAGAAGATGTTCAGCTGCTTTATC
ACTGGTAGGAGCAGTTCACATAAAACATCAAAAAGAGACAGGCTGACTGATGGTTCTAGG
GCTGATGCCCTTAAGGACCAAGAGTATGTTCTTACCTATGAAGACAAGGATGCTGACTGG
ATGCTTGTTGGTGATCTTCCTTGGGActtgtttactactagttgtcggaaactgcggatc
atgagaggttcagatgctgctggaatggCTCCGAGATCACTGGAACAGACAGGTCAGAAC
AAATAG

Protein

282 aa

>Os05t0559400-02 Similar to IAA11 (Fragment).
MPPPLEARDYIGLAASPASSSSSCCASTPVAEVVGAHLALRLGLPGSESPARAEAEAVVV
DAALTLGPAPPPRGGAKRGFVDSLDRSEGRRAAATAGDDERGVREEEEEEKGLGEAAAGA
PRAAKAQVVGWPPVRSYRKNTLAASATKTKGEDQGKSEVGCCYVKVSMDGAPYLRKVDLK
TYSSYEDLSLALEKMFSCFITGRSSSHKTSKRDRLTDGSRADALKDQEYVLTYEDKDADW
MLVGDLPWDLFTTSCRKLRIMRGSDAAGMAPRSLEQTGQNK*

5'UTR

chr05:27850268..27850352 (- strand) : 85 bp

CDS

chr05:27849894..27850267 (- strand) : 374 bp

chr05:27849005..27849234 (- strand) : 230 bp

chr05:27848059..27848200 (- strand) : 142 bp

chr05:27847291..27847352 (- strand) : 62 bp

chr05:27846491..27846528 (- strand) : 38 bp

3'UTR

chr05:27846200..27846490 (- strand) : 291 bp

FASTA

>Os05t0559400-02 class=Sequence position=chr05:27846200..27850352 (- strand)
AAGAACAAAA AGACATTCGC TTTCGCCTCT TCTCCCCCTC TCCTCTCCTC TCCTCTCCTC TCTGCGTGTG CATCTCTCGA
TTCCGATGCC GCCGCCGCTC GAAGCGCGAG ACTACATCGG GCTCGCGGCG TCCCCGGCCT CGTCCTCCTC CTCCTGCTGC
GCGTCGACCC CCGTCGCCGA GGTCGTCGGG GCGCACCTCG CGCTCCGCCT CGGCCTCCCG GGGTCGGAGT CGCCCGCCCG
CGCTGAGGCG GAGGCTGTCG TCGTCGACGC CGCGCTCACG CTCGGCCCTG CTCCTCCTCC CAGGGGCGGC GCCAAGCGCG
GGTTCGTCGA CTCCCTCGAC CGATCCGAGG GCCGTCGTGC TGCTGCCACC GCCGGTGATG ATGAGAGGGG CGTGAGGGAG
GAGGAGGAGG AGGAGAAGGG GTTGGGGGAA GCTGCTGCTG GAGCTCCGCG AGCTGCCAAG TAAGCATGCG TGCTCCTGTT
TGGTTTTGAG TTGGTTTGAT TTAGAGCTCT CTGGGCTAAT TTATAGCTTG TTAAATATAG GAATATTTGA TTTGCTGGTT
TGATGGCGCT TCATTAGTTC TAGATGTTAA AATAGGAGCA GTAGTGACCA ATTAAATTGA TACTAGTTCT CATGGTTATT
TTCTCTGGAA TGTAGAAATG ATCAAataca tagtaatagt atattttgct gtgctaattg ttagtcaaca gttataaagt
ttgaatcttg agacacacgt gcgcTTTATG TTCATCATTG GAGGGGGTAC TTGCTAAACT GAACACGGAA GAAAAAGATT
CCTGGTAAAA CCGCCACCTG ACTGGAAAAA GCTCGAGCTT TGTTGAAAAA TTGTCACATA ACCAGGTGTT GTGACCAAAT
GGTGCTGCCT CTCTTGATTT TCCACCTGCA CTGGTACTGT TGCTCAGGTG ATATAACTAA ACTGCTTAGG AGTTAGGATA
GAGATATGTA ATAAACTACT TGTAACCAGG TCTTGAAGGG TTCAAGGGAC CTGAGTTCAA TTTTTTCATG AAGTTGGTGG
TTAGTTGAAG ATCATATGTC ACTAGATATA TGTTTTGTTC TGAAACATTT AGTCTGATAG TATGTGTTTA TGCGCTAGGG
CACAAGTTGT TGGATGGCCA CCTGTGCGAA GCTACCGGAA GAATACATTG GCCGCCAGTG CCACAAAGAC AAAGGGGGAA
GACCAAGGCA AAAGTGAGGT AGGATGTTGC TATGTTAAGG TTAGCATGGA TGGAGCCCCA TACCTTAGGA AGGTTGACCT
CAAGACCTAT TCAAGCTATG AAGATCTTTC ACTTGCTCTT GAGAAGATGT TCAGCTGCTT TATCACTGGT GAGTATTTCT
GTTTTCTGTT TGTTTCTTTG TAGATTTGTT CAATTTGCTT TCTTTTGCAT GTAGCTTTAG ATGCCAATTA GTTTGGTTGT
GTACTTGTGT CATTGCGTGC ATCCTTATTT GGTACATAGA CTGGAAGTAA GTTATACTTC CATTATCCAA AAAAAATCAA
TTTGTGTGCA TTAGTTTGAT GAAATAGAAC GATATTTTGT GTGCATTAAA TATGTAGTTA AGACAGATAT TCTGTGTAAT
GAAATATTCC ATTATCTAAT AAAAAGACTG ATATAATCCA TGTCTTTTTT CCTCGCTTTT GGAAGATCTT CGGAGTTCTA
AAATAATGTA ATGATAGAAG GGGAAGCTGA TGCATGGCTA CTAGTGGATT TGGTCTAGCT GGACTACAGT TGCCAGATTA
TTTTGACTAA GCATATTTCT TCATCTGAGT CAAGTAGCCA AGAACTAACC GTAGAACAAT AAGTGCTGTG CTTAGATGCT
AAACCCTGTT TTCCTATGCG GCGGTGAAAC AATAGAAAAG TGATAATGAA GTCCATTAGT AAAAAGAGAA CTCTTGTGGT
AACTATGTTT GTTTAAAATT TGATTTGCTT ACTTTACCGA TATTTTGACA CAGTTATTGT GTTTGCACTG TATGTTTGTG
TAAGTTGAAA TAGCATTTCC ATTTTTACTA AGCCCATGTA TACCTTGATT TTGGGACGCT CGTGTGTATT CAACTACAAA
AGTGCTTTCT ATTGTCTGTA TTTTACATAT ATCCAGGAAA CATATTAATG GTTGACTTGT TTTGCAATAC AGGTAGGAGC
AGTTCACATA AAACATCAAA AAGAGACAGG CTGACTGATG GTTCTAGGGC TGATGCCCTT AAGGACCAAG AGTATGTTCT
TACCTATGAA GACAAGGATG CTGACTGGAT GCTTGTTGGT GATCTTCCTT GGGAGTGAGT TCTAACTTTG TGATCATGCA
TCTTATCTTA TTTAAATTGT GATGGTTTTT ATGATTTTCT CTTGCGGCAT TCTTGTCTTG CATAGAATAC GTTCAGACAT
TCAGATAACA GTATTCTTCT GCTGTTGATG CAGTAACTGT AGTTAGGAGA TCTTGATAGT GTATGATGGG AGCTTGATTT
ACCAATAATG TTACTTCTTC TAGTGGTTTG AACTCGATAA CACATTACTA ACACTTATGA TGATATTTGG AGTCAACTAA
AATTATGCAA ACCAATGCCC TGTAACTTGC TGAAAAGTTA GATGGACTCG TGTAAAATGT TTATTCAAGT CTCTCTCTCT
AGAGTTCTCT GAGTACTCCA GTTTCACTCT TCAGTATGAA TTAGAATTAT AAATCCTTTC TGAATTTTGA TTGTTCTCTT
TGAGAAAGTT CGAGTTCTAT GGGCAATGTT TTTTCATACT TTTAGTTGGC ACATTTCAAG AGTTTGTACA GTCTACCAAT
AAAAATTTAT CTTGTATAAA AATGTGTCAC TCCCACCCCT CAGTACTACA CTGTTTCGTA TATCAACAGA CAATTGTTCA
CAAGTTCAAT ATGACCTATG AATTGTTTGA CTGAGCTACC ATGTTTTTTT TTCCCGATGT Ttcagcagtt atttacaatc
attcttggtt accatctaat atcttgtaca tcattttcag cttgtttact actagttgtc ggaaactgcg gatcatgaga
ggttcagatg ctgctggaat gggtatgtGC AATATCTGTA GCACTTGGCC ATACTTTGAT TTCAAGGTTT CATGAGACAA
ATTAATCATT CAAGCATTCA CATGCTTTTC CATTGAGATG CGCATTATGC TAATATTGGT GATAACTTGG ACCTTGCTGG
TTAGTTGTAC CTGTACAATT ACAAATAAAT TATGTCACAT GTTTAAATTT TTCATTGATG TTTATTGGCA TAGCCTCAGA
TAACTTGAGT AACGGTAACT CGGTAAGACA TAAGACATGA AAAGGGTGAG GATATCGCAT GAAATTTACC AGTCCTACAA
TTGAAGACAC AAGTCTGATT GTATCCTTGA TTTTGGAATA AAGCAAGTGA ACAAATACAA CATGTTCTTT GGCCTTTGGA
GGTATATTCC TAAAATACAG AATACAAATA TAACTGCACG CCTTATGCAT CGTCTATTGC AACAAATCAC TAGTGATTTG
GCTGAAGGTG GATCAGTCCA CATTGCTAAA ATGCTAAAAG CCTAAAACTA TTTTGACTTA ATCTGGATGA CCTGGAACTC
TGCAACTAAG TATTACAGAT CTGCCTTTAT ATTTAGAGGC ATATCTAAAC ATCATTTTCC ATTGGTATCT GATATTTGGG
AACACTGGTG GATGCTCTCT CATTAGCTAG CAGCATTTTT CTTATGGGGT TTTGACCGTA ACTTCTTGAT AACTTAATGC
ATCGATTCCT TAACGAATAT GTATTGATTT GTCCTTGTCT GAAGTATCTT CTGTGTCCCT GCAGCTCCGA GATCACTGGA
ACAGACAGGT CAGAACAAAT AGTTGCCCGA GCTTTCATCA TCTGGACAGC AAATGTGTGG ACCAAGTTTG CTGTAGCAAG
TTTCCGCTGA GGGGTGCAGT GTTTTACCTG AAGTATCTCC GCTATTAGTT TATTTACGTG TGTAGTGAAA TCTGTGGCGT
ATTGTAAAAC AGCCATTTTG CCTACGAGGT TGTCTTGTGT CAATCTGTAG ATGGTCGATT TTGTCTTTGA AAGATCAAGT
CAGGCTGCTT AATGCTTCCT GTGTGATACT TTCATCAATT CTCTCATATA TATATTATCT GGAGTTGCAC TTG

Locus: Os05g0559400

Loading...

Locus: Os05g0559400

Loading...