Os05t0562200-01

Locus

Os05g0562200

Description

Drought induced 19 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-1

Oryzabase Gene Name Synonym(s)

drought-induced 19-1

Transcript Evidence

AK061766 (DDBJ, Best hit)

AK109438 (DDBJ, Best hit)

Protein Evidence

Q688X9 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Drought induced 19/ RING finger protein 114 (IPR008598)

Full-length cDNA

001-039-B10 (Online Clone Ordering)

006-310-F07 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0562200-01)

RiceXPro (AK061766)

Others

Oryzabase (18576)

KEGG (Os05t0562200-01)

Transcript

1387 bp

>Os05t0562200-01 Drought induced 19 family protein.
ATTCCTCACTCCTCCCCCGCATCTCACCTCACCTCACCTCCCGATAAGGCACGAGGAGAC
TATCTCCTCCCCCTCCTCCTCCTCTCCCCGCCGACGACCCCGCCGAGCTACATCTCCGCC
GTGCTGATCGCGTGGAGCCGAGGAGAGGAGCGGCGGCCAACGCTACGAGGAGAGGAGAGT
GGGGGAGGGGAGGGGAGCGAGCCTTATCTTACCCGCTCCGCCGAAGCCTATGGACTCGGA
GCACTGGATCTCGCGCCTGGCCGCCGCCAAGCGGTTCTACGCCGCGCAGCTCGGCCACGC
CGATCGAGCGGGGATGGAGGAGGTGGACATGGACGAGGAGGTGAGGCCGGAGTTCGCGTG
CCCCTACTGCTACGAGGACCACGACGTCGTCTCCCTCTGCGCGCACCTGGAGGAGGAGCA
CCCCTTCGAGCCCCATGCGGCGCCTTGCCCTATATGTTCTGATAAGATTGCAAAAGATAT
GCTTAATCATATCACTGTGCAACATGGGTACTTGTTCAAGAATCGTCGCAGGTTGCGCAG
ATTCGTTATTCCAGGCAGTCAAGCCCTATCTTTGCTGAGTCGAGATCTACGTGAAGCCCA
TTTGCAGGTGCTTCTGGGAGGTGGGGGACATAGGTCAAACAACAGCAGCAACACAACAAA
TATTTCAGCTGACCCTCTTCTGTCATCGTTTGGCCTTAGCTTTCCAACATCAGACACAGA
GGAAACATCAAAACCACCTATTTCCATTCCAGATGATGCATCTGTGATAAAAGAGACACC
TGCTCAGCCATGGGATTCAAGTATTGACTCATCCCTCACAAGGGAAGAAAGGGAACAGAA
ACGGAAGCAAGCGAGTGTCAGAGCAACATTTGTGCAAGACCTGCTGCTCACTACTTTATT
TGGAGATTAATAAATCAAGATGAGCCTAAGTAGTCGATAGATGCATGGGTAAATCCTGGT
GCATATTTGCATAGATAAGTGCCCGGTCAAATTGCTGAAGGTAATATCCATGGCAGATAG
GCACGCTTCTGCGGCACCAGGCGTCGTTTCCTCCCGTAAGGTGCAGAGTTGATGTGGGCA
CGGGGGCATCTTAAGTGTTATTGTAGCCGGTCTGTAATCTGTATCTCCAGTTCCATAACA
ATCCGCGATCAGCATACGATACACGTAGCAGATCGCGGTTGTGTTTGTAGCGCTTCTATG
TTTAGAAGCATTGGTTTCTTGTACCAACGTAATAATTATGTTACGGGACAGCAGAATGGT
ATGCAGTTTGTCTACTTCTGTGAGAGTATAATAAACCAAGTTTACAACTGGTTGGTTTTG
GAAGATTATGCTGTAAGATGAAGCATCTGTAACGTGTTGTACGTGATGGTATCACTTGTA
CCGTGCC

CDS

681 bp

>Os05t0562200-01 Drought induced 19 family protein.
ATGGACTCGGAGCACTGGATCTCGCGCCTGGCCGCCGCCAAGCGGTTCTACGCCGCGCAG
CTCGGCCACGCCGATCGAGCGGGGATGGAGGAGGTGGACATGGACGAGGAGGTGAGGCCG
GAGTTCGCGTGCCCCTACTGCTACGAGGACCACGACGTCGTCTCCCTCTGCGCGCACCTG
GAGGAGGAGCACCCCTTCGAGCCCCATGCGGCGCCTTGCCCTATATGTTCTGATAAGATT
GCAAAAGATATGCTTAATCATATCACTGTGCAACATGGGTACTTGTTCAAGAATCGTCGC
AGGTTGCGCAGATTCGTTATTCCAGGCAGTCAAGCCCTATCTTTGCTGAGTCGAGATCTA
CGTGAAGCCCATTTGCAGGTGCTTCTGGGAGGTGGGGGACATAGGTCAAACAACAGCAGC
AACACAACAAATATTTCAGCTGACCCTCTTCTGTCATCGTTTGGCCTTAGCTTTCCAACA
TCAGACACAGAGGAAACATCAAAACCACCTATTTCCATTCCAGATGATGCATCTGTGATA
AAAGAGACACCTGCTCAGCCATGGGATTCAAGTATTGACTCATCCCTCACAAGGGAAGAA
AGGGAACAGAAACGGAAGCAAGCGAGTGTCAGAGCAACATTTGTGCAAGACCTGCTGCTC
ACTACTTTATTTGGAGATTAA

Protein

227 aa

>Os05t0562200-01 Drought induced 19 family protein.
MDSEHWISRLAAAKRFYAAQLGHADRAGMEEVDMDEEVRPEFACPYCYEDHDVVSLCAHL
EEEHPFEPHAAPCPICSDKIAKDMLNHITVQHGYLFKNRRRLRRFVIPGSQALSLLSRDL
REAHLQVLLGGGGHRSNNSSNTTNISADPLLSSFGLSFPTSDTEETSKPPISIPDDASVI
KETPAQPWDSSIDSSLTREEREQKRKQASVRATFVQDLLLTTLFGD*

5'UTR

chr05:27970595..27970823 (- strand) : 229 bp

CDS

chr05:27970522..27970594 (- strand) : 73 bp

chr05:27970250..27970389 (- strand) : 140 bp

chr05:27969136..27969213 (- strand) : 78 bp

chr05:27968700..27968980 (- strand) : 281 bp

chr05:27968114..27968222 (- strand) : 109 bp

3'UTR

chr05:27967637..27968113 (- strand) : 477 bp

FASTA

>Os05t0562200-01 class=Sequence position=chr05:27967637..27970823 (- strand)
ATTCCTCACT CCTCCCCCGC ATCTCACCTC ACCTCACCTC CCGATAAGGC ACGAGGAGAC TATCTCCTCC CCCTCCTCCT
CCTCTCCCCG CCGACGACCC CGCCGAGCTA CATCTCCGCC GTGCTGATCG CGTGGAGCCG AGGAGAGGAG CGGCGGCCAA
CGCTACGAGG AGAGGAGAGT GGGGGAGGGG AGGGGAGCGA GCCTTATCTT ACCCGCTCCG CCGAAGCCTA TGGACTCGGA
GCACTGGATC TCGCGCCTGG CCGCCGCCAA GCGGTTCTAC GCCGCGCAGC TCGGCCACGC CGGTGCGTCC ACCTCGCTCT
CTCTCTCTTC TCCTCGGATT TGTTCGATTT CTCCCTTTTG CCGTGCGGTG CGGGGGCTGT TTAATGGGGG GATTTTTTTT
TTCTGATTAT TTGGTTTGGT TTTGCTGGGT GCAGATCGAG CGGGGATGGA GGAGGTGGAC ATGGACGAGG AGGTGAGGCC
GGAGTTCGCG TGCCCCTACT GCTACGAGGA CCACGACGTC GTCTCCCTCT GCGCGCACCT GGAGGAGGAG CACCCCTTCG
AGCCCCATGC GGCGGTGAGT TGTTCGTCCC CCTCGTAATC TGCTCTTGTT GGATGAGTAG AAGAGATGGC GTTCTTTGTT
TTGGTTGACC TGGAGGACGA GCTCATGCTT AGAGCATATG TTGCTGAATT AAAAGATGGA AAGCTTGAGG TGTTGACCTG
TACAGCGATG CAATTTTAGT TGGATCATTC TCTTGGGCAT CGAAAGTAGT AATCAAGTTT GTAGTTTTGC ATGGAGCCAC
GACCAGATTT GGGGCTGCGC AAAAATAGGT ATATGGAGAG GCAAAAAAAA AAGAAGTGGA AATGTTGGCA ATCGTTGATG
TTATAAGCAA ATGCTTGAGG AAATGATAGC GTACTTAACT GTGGTTAATA TATATAGCCA TCAGCTCTCC AAAGATAAGT
TAAGGCTCCA GTTGAAATGA GGAATGGTAA AATACATGAA Taggagaagc acaggaaata gatgacaaag atagactcaa
aggaaatttt ccaagaggtt gtatctcttg ctagctttcc tctaaaatct acatgtattg agccattcct aaggaatttc
ataggatttg agaagctcca atcctttgtt tcagaggacc aaatatgaaa ctttcctata ggattggaat cctacaaaat
tcctccacaa atcctttgtt tcaaaggagg ccTAAATTTT GCTTGCCTCA GTTTTCAGGA TCAGCTTGTC CGAAGTTCAT
ATGGTCACTA GTTCGTTTAT TAGGTAAAAC TTGAGTATGT GTTATGGAAC CTGGAGTGAA AGAGAAAGTT TGCTCTTGCC
ATCTTGTTGT GCAGCTGCTT TGCGTAAGGT GTAAAAACAG ATTAGCTTTT GTATTTTGTG AAAAAAAAAT CAAATTGTTC
TGTGTTGGAC TCACACAGAT GCCTCTTTTC TTATTCCTCA ACTGCATAAT CTTGTGTTTA TCTGTTCTAC TGCAAGCTCT
ATACATGGCT GGAAATATAT TTTCTTTCCT TGTAATATTC TAGATAACAG TTTATTGTCT TGTTTTGATT GTTTCTTTCC
TTCATTTCAG CCTTGCCCTA TATGTTCTGA TAAGATTGCA AAAGATATGC TTAATCATAT CACTGTGCAA CATGGGTACT
TGTTCAAGGT ACTTCCGCTT TCCTGTATAT TTATCTAGTG CCTACTCAAC CAATCAGCCC CATGTAATAC ATGCTGTGGA
TGACAGCTGA TGCATAAAAG ATATATATTT TTGAGTTTTG AGAGGTTCAC GCTTGAGGTT TGCTAATTTT ATACAACCTG
CAGAATCGTC GCAGGTTGCG CAGATTCGTT ATTCCAGGCA GTCAAGCCCT ATCTTTGCTG AGTCGAGATC TACGTGAAGC
CCATTTGCAG GTGCTTCTGG GAGGTGGGGG ACATAGGTCA AACAACAGCA GCAACACAAC AAATATTTCA GCTGACCCTC
TTCTGTCATC GTTTGGCCTT AGCTTTCCAA CATCAGACAC AGAGGAAACA TCAAAACCAC CTATTTCCAT TCCAGATGAT
GCATCTGTGA TAAAAGAGAC ACCTGCTCAG CCATGGGATT CAAGGTATTT GCTCTTGTTC GTGCTAGATA GAAACACGTG
GTATACTCGA AGGTTGTAGT GATTACCTTG TTCCTTGTTA TCCTCCTGAA TAACACCTGA GACTTGGTTG TCTTGCAAAT
TCAGAACTAG CATCGCTATC TGACTCATCA CAAAATTTCA TAAAAGCTAT TGTTGTACTC GTGCCCTATG TCAATGTTTA
GTTTCAATGC AATTTTAAGT ACAATACGTT CAGAGAACAT GAGCTCATGT TTGATCACAA TAATTCGAGT CCAATAAGAT
AAGCCAGTAT ATTCCGTTGA TAATAGCATT GTACGAAGTA CTGAATAAAT GTACAGTAGC AAGTTGTTTG ACTGATGAGT
AGCGTGTAGC AACAAGCTGC TGTATGGCTT CCTGCATGTT AGGACTATTT GGGAGGTATA CATTATAAAT TTCAAATTTT
GGCAGTTGAA TGATCTGCTA ATTTTTTTTT TTCATTTGCA GTATTGACTC ATCCCTCACA AGGGAAGAAA GGGAACAGAA
ACGGAAGCAA GCGAGTGTCA GAGCAACATT TGTGCAAGAC CTGCTGCTCA CTACTTTATT TGGAGATTAA TAAATCAAGA
TGAGCCTAAG TAGTCGATAG ATGCATGGGT AAATCCTGGT GCATATTTGC ATAGATAAGT GCCCGGTCAA ATTGCTGAAG
GTAATATCCA TGGCAGATAG GCACGCTTCT GCGGCACCAG GCGTCGTTTC CTCCCGTAAG GTGCAGAGTT GATGTGGGCA
CGGGGGCATC TTAAGTGTTA TTGTAGCCGG TCTGTAATCT GTATCTCCAG TTCCATAACA ATCCGCGATC AGCATACGAT
ACACGTAGCA GATCGCGGTT GTGTTTGTAG CGCTTCTATG TTTAGAAGCA TTGGTTTCTT GTACCAACGT AATAATTATG
TTACGGGACA GCAGAATGGT ATGCAGTTTG TCTACTTCTG TGAGAGTATA ATAAACCAAG TTTACAACTG GTTGGTTTTG
GAAGATTATG CTGTAAGATG AAGCATCTGT AACGTGTTGT ACGTGATGGT ATCACTTGTA CCGTGCC

Locus: Os05g0562200

Loading...

Locus: Os05g0562200

Loading...