Os05t0562300-01

Locus

Os05g0562300

Description

Similar to DnaJ-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjB7, DjB7

Oryzabase Gene Name Synonym(s)

DnaJ domain protein B7

Transcript Evidence

AK067414 (DDBJ, Best hit)

Protein Evidence

NP_001149016.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

J013101C03 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0562300-01)

RiceXPro (AK067414)

Others

Oryzabase (12155)

KEGG (Os05t0562300-01)

Transcript

1453 bp

>Os05t0562300-01 Similar to DnaJ-like protein.
CCCCTCTTTTCTTCCCCCCTCTCTCTCCCCCCAGCATCGTACCAAACCACACAACCGCAG
CGACGGCAACACGAAGCTCTCCTCTCCGGCGAGAATAGCCAAGAACGCGACGCGACCACA
CCCAAGAGGCCGAACAGATCGAGCTCAAGAAGGTTTTAGCCCATGGGGATGGATTACTAC
AAGATCCTGGGCGTCGACAAGGCCGCCAGCGACGACGACCTCAAGAAGGCGTACCGCAAG
CTCGCCATGAAGTGGCACCCTGACAAGAACCCCAACAACAAGAAGGAGGCGGAGAACAAG
TTCAAGCAGATCTCCGAGGCGTACGAGGTGCTGAGCGACCCGCAGAAGCGAGCGGTGTAC
GACCAGTACGGCGAGGAGGGGCTCAAGGGGCAGGTCCCGCCGCCGGGCGCCGGCGGGGCC
GGCCCGGGAGGCGCGACGTTCTTCTCCACCGGCGGCGACGGGCCCAACGTGTTCCGGTTC
AACCCGCGCAACGCGGAGGACATCTTCGCGGAGTTCTTCGGCTCGTCCAGCCCGTTCGGC
GGCATGGGCGGTGGCATGGGCGGCGGCATGGGGGGAGGGCCCGGGATGCGGACAGGCGGC
ACGCGGTTCTCGTCGTCGATCTTCGGGGACGACATCTTCGGCTCGGCGTTCGGCGGCGGC
GCCGACGGGCACCACGGGATGCACGGCGGTGGCGCCGGGAGGGCGTTGAAGGCGCCGGCG
ATCGAGAGGAAGCTGCCGTGCAGCCTGGAGGAGCTCTACAAAGGCACCACCAAGAAGATG
AAGATTTCCAGGGAAATCGCTGACGCCAGTGGGAAGACAATTCCAGTGGAGGAGATCCTG
ACCATCGATGTGAAGCCTGGGTGGAAGAAGGGCACCAAGATCACCTTCCCGGAGAAAGGA
AACGAGCAGCCGAACGTGATCCCGGCCGACCTCGTCTTCATCATCGACGAGAAGCCGCAC
CCGGTGTTCACCCGTGACGGCAACGACCTCGTCGTGACGCAGAAGATACCGCTCGCCGAG
GCCCTGACCGGCCACACCGTCCACCTGACTACGCTCGACGGCCGCAGCCTGACGATCCCG
ATCACCTCCGTCATCAACCCGGGCTACGAGGAGGTCGTCCGCGGCGAGGGCATGCCCATC
CCCAAGGACCCCTCCAAGAAGGGCAATCTCAGGGTCAAGTTCGACATCAAGTTCCCGGCG
AGGCTCACCGCCGACCAGAAGTCCGGCGTCAAGCGGCTGCTGGGGCAGTAGATCGAGCAA
CTGCACCGATGTAGTATCAAAGCCTTTTCTTGTGTTGGTGGTGTTGAACTGGTGATCATC
CGGCAGCCGCGACGAATTTCTCGTTGAGAGCTTTTTCAGGTCATGTGACACGATGCAAAA
AGGCAATGCGGCCTTAGATGTGTGAGATACTGATGAGAACTAGTAGAAACGTTATACACA
GCTTTTGTGGTGC

CDS

1089 bp

>Os05t0562300-01 Similar to DnaJ-like protein.
ATGGGGATGGATTACTACAAGATCCTGGGCGTCGACAAGGCCGCCAGCGACGACGACCTC
AAGAAGGCGTACCGCAAGCTCGCCATGAAGTGGCACCCTGACAAGAACCCCAACAACAAG
AAGGAGGCGGAGAACAAGTTCAAGCAGATCTCCGAGGCGTACGAGGTGCTGAGCGACCCG
CAGAAGCGAGCGGTGTACGACCAGTACGGCGAGGAGGGGCTCAAGGGGCAGGTCCCGCCG
CCGGGCGCCGGCGGGGCCGGCCCGGGAGGCGCGACGTTCTTCTCCACCGGCGGCGACGGG
CCCAACGTGTTCCGGTTCAACCCGCGCAACGCGGAGGACATCTTCGCGGAGTTCTTCGGC
TCGTCCAGCCCGTTCGGCGGCATGGGCGGTGGCATGGGCGGCGGCATGGGGGGAGGGCCC
GGGATGCGGACAGGCGGCACGCGGTTCTCGTCGTCGATCTTCGGGGACGACATCTTCGGC
TCGGCGTTCGGCGGCGGCGCCGACGGGCACCACGGGATGCACGGCGGTGGCGCCGGGAGG
GCGTTGAAGGCGCCGGCGATCGAGAGGAAGCTGCCGTGCAGCCTGGAGGAGCTCTACAAA
GGCACCACCAAGAAGATGAAGATTTCCAGGGAAATCGCTGACGCCAGTGGGAAGACAATT
CCAGTGGAGGAGATCCTGACCATCGATGTGAAGCCTGGGTGGAAGAAGGGCACCAAGATC
ACCTTCCCGGAGAAAGGAAACGAGCAGCCGAACGTGATCCCGGCCGACCTCGTCTTCATC
ATCGACGAGAAGCCGCACCCGGTGTTCACCCGTGACGGCAACGACCTCGTCGTGACGCAG
AAGATACCGCTCGCCGAGGCCCTGACCGGCCACACCGTCCACCTGACTACGCTCGACGGC
CGCAGCCTGACGATCCCGATCACCTCCGTCATCAACCCGGGCTACGAGGAGGTCGTCCGC
GGCGAGGGCATGCCCATCCCCAAGGACCCCTCCAAGAAGGGCAATCTCAGGGTCAAGTTC
GACATCAAGTTCCCGGCGAGGCTCACCGCCGACCAGAAGTCCGGCGTCAAGCGGCTGCTG
GGGCAGTAG

Protein

363 aa

>Os05t0562300-01 Similar to DnaJ-like protein.
MGMDYYKILGVDKAASDDDLKKAYRKLAMKWHPDKNPNNKKEAENKFKQISEAYEVLSDP
QKRAVYDQYGEEGLKGQVPPPGAGGAGPGGATFFSTGGDGPNVFRFNPRNAEDIFAEFFG
SSSPFGGMGGGMGGGMGGGPGMRTGGTRFSSSIFGDDIFGSAFGGGADGHHGMHGGGAGR
ALKAPAIERKLPCSLEELYKGTTKKMKISREIADASGKTIPVEEILTIDVKPGWKKGTKI
TFPEKGNEQPNVIPADLVFIIDEKPHPVFTRDGNDLVVTQKIPLAEALTGHTVHLTTLDG
RSLTIPITSVINPGYEEVVRGEGMPIPKDPSKKGNLRVKFDIKFPARLTADQKSGVKRLL
GQ*

5'UTR

chr05:27974446..27974607 (- strand) : 162 bp

CDS

chr05:27974281..27974445 (- strand) : 165 bp

chr05:27973681..27974165 (- strand) : 485 bp

chr05:27972664..27973102 (- strand) : 439 bp

3'UTR

chr05:27972462..27972663 (- strand) : 202 bp

FASTA

>Os05t0562300-01 class=Sequence position=chr05:27972462..27974607 (- strand)
CCCCTCTTTT CTTCCCCCCT CTCTCTCCCC CCAGCATCGT ACCAAACCAC ACAACCGCAG CGACGGCAAC ACGAAGCTCT
CCTCTCCGGC GAGAATAGCC AAGAACGCGA CGCGACCACA CCCAAGAGGC CGAACAGATC GAGCTCAAGA AGGTTTTAGC
CCATGGGGAT GGATTACTAC AAGATCCTGG GCGTCGACAA GGCCGCCAGC GACGACGACC TCAAGAAGGC GTACCGCAAG
CTCGCCATGA AGTGGCACCC TGACAAGAAC CCCAACAACA AGAAGGAGGC GGAGAACAAG TTCAAGCAGA TCTCCGAGGC
GTACGAGGTA AGCAGCCAGA CAGAGATCTG TTTCTGAGTG GATTCGTTTT TTTGCTGAAT TGGGCAATGA CGTGACGCTT
CCATGGTGTT TGTGTTTGTG CTTGTGCTGG GTGTCGGCGT AGGTGCTGAG CGACCCGCAG AAGCGAGCGG TGTACGACCA
GTACGGCGAG GAGGGGCTCA AGGGGCAGGT CCCGCCGCCG GGCGCCGGCG GGGCCGGCCC GGGAGGCGCG ACGTTCTTCT
CCACCGGCGG CGACGGGCCC AACGTGTTCC GGTTCAACCC GCGCAACGCG GAGGACATCT TCGCGGAGTT CTTCGGCTCG
TCCAGCCCGT TCGGCGGCAT GGGCGGTGGC ATGGGCGGCG GCATGGGGGG AGGGCCCGGG ATGCGGACAG GCGGCACGCG
GTTCTCGTCG TCGATCTTCG GGGACGACAT CTTCGGCTCG GCGTTCGGCG GCGGCGCCGA CGGGCACCAC GGGATGCACG
GCGGTGGCGC CGGGAGGGCG TTGAAGGCGC CGGCGATCGA GAGGAAGCTG CCGTGCAGCC TGGAGGAGCT CTACAAAGGC
ACCACCAAGA AGATGAAGAT TTCCAGGGAA ATCGCTGACG CCAGTGGGTA AGTCTCTCTC CCTTTGCTTC ACAGATCACA
AAATTAACAA TCTTGTTTAC TGGAGTATGT CCTAGCATTA ACGATTTGTC ACTTGTTAGT ACTGATTTAG TATTGTAGCA
CTGTTATCAG ATTGGAAATT GTGATGGATG CTTAAAACTG TTTTGATTTA GTATGCAATT AGCATCAGCG ATTTTTGTTT
TTTTCGAACG GCCATTAGCG ATTTTTGTTA GCAGTACTTA TTTAGTACTG CAGCACTTGT GTCAATTGAA TTTGGGATGG
ATGCTTAAAA CTGTTTCCAT CCAAATAGTT TTAATTTCAT ACATTCTCCA AATTACAGCG TGTTCTAGAT AGATAGTAat
tgagatatgg attatttgtg ccacgcttct aatattatga tttcttcaca aactgcattg tgtagacaac ttctttaagc
tagttgtatt tgttagctat attagtattt aatCAATTGC TTGAGCAATT CTCCTCGGTC CTTAATCTAA TAATCCAATG
TGGCAGAGCC TTATGTTTCA GTTCGTATTG TGTACTGAAC AATGCTGCTC ATTGTGATTG TGCAGGAAGA CAATTCCAGT
GGAGGAGATC CTGACCATCG ATGTGAAGCC TGGGTGGAAG AAGGGCACCA AGATCACCTT CCCGGAGAAA GGAAACGAGC
AGCCGAACGT GATCCCGGCC GACCTCGTCT TCATCATCGA CGAGAAGCCG CACCCGGTGT TCACCCGTGA CGGCAACGAC
CTCGTCGTGA CGCAGAAGAT ACCGCTCGCC GAGGCCCTGA CCGGCCACAC CGTCCACCTG ACTACGCTCG ACGGCCGCAG
CCTGACGATC CCGATCACCT CCGTCATCAA CCCGGGCTAC GAGGAGGTCG TCCGCGGCGA GGGCATGCCC ATCCCCAAGG
ACCCCTCCAA GAAGGGCAAT CTCAGGGTCA AGTTCGACAT CAAGTTCCCG GCGAGGCTCA CCGCCGACCA GAAGTCCGGC
GTCAAGCGGC TGCTGGGGCA GTAGATCGAG CAACTGCACC GATGTAGTAT CAAAGCCTTT TCTTGTGTTG GTGGTGTTGA
ACTGGTGATC ATCCGGCAGC CGCGACGAAT TTCTCGTTGA GAGCTTTTTC AGGTCATGTG ACACGATGCA AAAAGGCAAT
GCGGCCTTAG ATGTGTGAGA TACTGATGAG AACTAGTAGA AACGTTATAC ACAGCTTTTG TGGTGC

Locus: Os05g0562300

Loading...

Locus: Os05g0562300

Loading...