Os05t0563000-01

Locus

Os05g0563000

Description

NAC family transcription factor, Secondary cell wall biosynthesis, Positive regulator of cellulose biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsSND2

RAP-DB Gene Name Synonym(s)

SECONDARY WALL-ASSOCIATED NAC DOMAIN PROTEIN 2

CGSNL Gene Symbol

NAC62

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 62

Oryzabase Gene Symbol Synonym(s)

ONAC062, ONAC62, OsSND2, SND2

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 062, NAC domain-containing protein 62, SECONDARY WALL-ASSOCIATED NAC DOMAIN PROTEIN2, SECONDARY WALL-ASSOCIATED NAC DOMAIN PROTEIN 2

Transcript Evidence

AK100983

Protein Evidence

Q6AUG9

Literature

PMID: 29855737

Note

Manual Curation

June 5, 2018

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain superfamily (IPR036093)

NAC domain (IPR003441)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023145A15 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0563000-01)

RiceXPro (AK100983)

Others

Oryzabase (11491)

KEGG (Os05t0563000-01)

Transcript

1538 bp

>Os05t0563000-01 NAC family transcription factor, Secondary cell wall biosynthesis, Positive regulator of cellulose biosynthesis
AAGCTTTCCTTCTTCTTTTTTCCCCCTCTCGACGATCTCTCTCTCATCAGGACCCCGGCC
TTAAGTTGTTTCTTCCCTATCAGCTCAGGTCTCTCTCGATCTCTCCTAGCTAGATAGATA
GCTTAATTAGCAGCTAGAGATGTGTCTCTAGCTAAGCTAACTAGCTAGTAGGCTTCTTCT
TTTAATCCGGCATTGTTCTTGGCTGCTGGTCTTAGTTTTTGGCTGTCATGTATGGAGTTA
GTGGTAAAATACTAGGTTAATTAATAATATAAGGCGTGTGTATATATTGGTGTGGAGGAG
GAGGAGAAAGGGGGTTGGCCGGAGAGATCGATGACGTGGTGCAACAGCTTCAGCGACGTC
CGCACCGCCGTGGACAGCAGCTTGTCGCCGGCCGCCGCCGTGGCCGCCGCCGCGGGGAAG
AAGGCGGCGGCGTCGCTCGCCGTCCTCGTCAAGATGTGCCCCTCCTGCGGCCACCGCGCG
CGGTATGAACAGGAGACGACGACGATCCAGGACCTGCCGGGGCTGCCGGCCGGAGTGAAG
TTCGATCCGACGGACCAGGAGCTTCTTGAGCATTTGGAAGGGAAGGCGAGGCCGGACTCG
AGGAAGCTCCACCCTCTCGTCGACGAGTTCATCCCCACCATCGAGGGCGAGAATGGCATC
TGCTACACCCATCCCGAGAGGCTTCCCGGTGTGAGCAAGGACGGGCTGGTGAGGCACTTC
TTCCACCGGCCGTCGAAGGCGTACACGACGGGGACGAGGAAGCGGCGGAAGGTGCACAGC
GACGAGGTCGACGGCGGCGAGACGCGGTGGCACAAGACCGGCAAGACGAGACCGGTGATG
GCCAACGGCCGGCCCAGGGGCTACAAGAAGATCCTCGTCCTCTACACCAACTACGGCAAG
CAGCGCAAGCCGGAGAAGACCAACTGGGTGATGCACCAGTACCACCTCGGCTCCGACGAG
GAGGAGCGGGACGGCGAGCTCGTCGTCTCCAAGGTCTTCTTCCAGACGCAGCCCAGGCAG
TGCGGCTCCACCGCCGCCGCCGCCGCCGCCAAGGAGGCCTCCGCCGCCGTCGCCGCCGCC
GTGGTGAACAGCAACTACTCCATCGTCCATGGCCATCAAGGTGGTGGTGGTGGTAGCTTT
CTCAAGGAGGCAAACGTTGTGCACGAGTTCTACGACCCGGCAGCAACGATGGGTTACCGG
CCACCTGCTCCTGCTGCGCACTTCGCGCCAAACTTCGCGGTGCACGCGGCAAGGAACAGC
TTTGGTGGCCCTTGAAGGAAAAACCAAAATTACACAAAATCTAAACATTACCGTTTATAC
CGATATGATTCACATAGGTGCCATTATATTACATTCTTAACCTTACATTCATCCATCAGT
TATTTGCAGTTTTGTTCAAAGTTGTTATATCGTTTCCGATGCTATACTGTGCAAAGATTA
TTACTACACGCCGTTCTAACTCGAAAATGTCAATTAATGTATCAGTTTGTACATGTATAC
ATGCACACGGAAGAGGTCCTGATGATGCATCACTTCAT

CDS

945 bp

>Os05t0563000-01 NAC family transcription factor, Secondary cell wall biosynthesis, Positive regulator of cellulose biosynthesis
ATGACGTGGTGCAACAGCTTCAGCGACGTCCGCACCGCCGTGGACAGCAGCTTGTCGCCG
GCCGCCGCCGTGGCCGCCGCCGCGGGGAAGAAGGCGGCGGCGTCGCTCGCCGTCCTCGTC
AAGATGTGCCCCTCCTGCGGCCACCGCGCGCGGTATGAACAGGAGACGACGACGATCCAG
GACCTGCCGGGGCTGCCGGCCGGAGTGAAGTTCGATCCGACGGACCAGGAGCTTCTTGAG
CATTTGGAAGGGAAGGCGAGGCCGGACTCGAGGAAGCTCCACCCTCTCGTCGACGAGTTC
ATCCCCACCATCGAGGGCGAGAATGGCATCTGCTACACCCATCCCGAGAGGCTTCCCGGT
GTGAGCAAGGACGGGCTGGTGAGGCACTTCTTCCACCGGCCGTCGAAGGCGTACACGACG
GGGACGAGGAAGCGGCGGAAGGTGCACAGCGACGAGGTCGACGGCGGCGAGACGCGGTGG
CACAAGACCGGCAAGACGAGACCGGTGATGGCCAACGGCCGGCCCAGGGGCTACAAGAAG
ATCCTCGTCCTCTACACCAACTACGGCAAGCAGCGCAAGCCGGAGAAGACCAACTGGGTG
ATGCACCAGTACCACCTCGGCTCCGACGAGGAGGAGCGGGACGGCGAGCTCGTCGTCTCC
AAGGTCTTCTTCCAGACGCAGCCCAGGCAGTGCGGCTCCACCGCCGCCGCCGCCGCCGCC
AAGGAGGCCTCCGCCGCCGTCGCCGCCGCCGTGGTGAACAGCAACTACTCCATCGTCCAT
GGCCATCAAGGTGGTGGTGGTGGTAGCTTTCTCAAGGAGGCAAACGTTGTGCACGAGTTC
TACGACCCGGCAGCAACGATGGGTTACCGGCCACCTGCTCCTGCTGCGCACTTCGCGCCA
AACTTCGCGGTGCACGCGGCAAGGAACAGCTTTGGTGGCCCTTGA

Protein

315 aa

>Os05t0563000-01 NAC family transcription factor, Secondary cell wall biosynthesis, Positive regulator of cellulose biosynthesis
MTWCNSFSDVRTAVDSSLSPAAAVAAAAGKKAAASLAVLVKMCPSCGHRARYEQETTTIQ
DLPGLPAGVKFDPTDQELLEHLEGKARPDSRKLHPLVDEFIPTIEGENGICYTHPERLPG
VSKDGLVRHFFHRPSKAYTTGTRKRRKVHSDEVDGGETRWHKTGKTRPVMANGRPRGYKK
ILVLYTNYGKQRKPEKTNWVMHQYHLGSDEEERDGELVVSKVFFQTQPRQCGSTAAAAAA
KEASAAVAAAVVNSNYSIVHGHQGGGGGSFLKEANVVHEFYDPAATMGYRPPAPAAHFAP
NFAVHAARNSFGGP*

5'UTR

chr05:28003165..28003494 (+ strand) : 330 bp

CDS

chr05:28003495..28003656 (+ strand) : 162 bp

chr05:28003835..28004030 (+ strand) : 196 bp

chr05:28004150..28004736 (+ strand) : 587 bp

3'UTR

chr05:28004737..28004999 (+ strand) : 263 bp

FASTA

>Os05t0563000-01 class=Sequence position=chr05:28003165..28004999 (+ strand)
AAGCTTTCCT TCTTCTTTTT TCCCCCTCTC GACGATCTCT CTCTCATCAG GACCCCGGCC TTAAGTTGTT TCTTCCCTAT
CAGCTCAGGT CTCTCTCGAT CTCTCCTAGC TAGATAGATA GCTTAATTAG CAGCTAGAGA TGTGTCTCTA GCTAAGCTAA
CTAGCTAGTA GGCTTCTTCT TTTAATCCGG CATTGTTCTT GGCTGCTGGT CTTAGTTTTT GGCTGTCATG TATGGAGTTA
GTGGTAAAAT ACTAGGTTAA TTAATAATAT AAGGCGTGTG TATATATTGG TGTGGAGGAG GAGGAGAAAG GGGGTTGGCC
GGAGAGATCG ATGACGTGGT GCAACAGCTT CAGCGACGTC CGCACCGCCG TGGACAGCAG CTTGTCGCCG GCCGCCGCCG
TGGCCGCCGC CGCGGGGAAG AAGGCGGCGG CGTCGCTCGC CGTCCTCGTC AAGATGTGCC CCTCCTGCGG CCACCGCGCG
CGGTATGAAC AGGTATATAT ACTGCGTGAT CAAGATCATG CCTTCTTCTT CTTCTTTTTT TCTGAATGCA ACAGCCAACA
GCTATAAATT CAGCAAGTGA TAACTGATCA TATATACTGC GTAGTACTAC ATTAATTCTT CTTTTGGTTG AGATGCAAAT
CAACAAATTA ATTAAGATGA ATTATTGCAG GAGACGACGA CGATCCAGGA CCTGCCGGGG CTGCCGGCCG GAGTGAAGTT
CGATCCGACG GACCAGGAGC TTCTTGAGCA TTTGGAAGGG AAGGCGAGGC CGGACTCGAG GAAGCTCCAC CCTCTCGTCG
ACGAGTTCAT CCCCACCATC GAGGGCGAGA ATGGCATCTG CTACACCCAT CCCGAGAGGC TTCCCGGTGG GTGTAAATTC
TTTTTTCTTA CAGTGGAATC AGAATCGGTA GCTTAAAATT CTTGATAAAT GAGTTGATCG TTGCGTGCAT TTGTGGGTGT
AAATAAATTT GAAAAATTAA TTCAGGTGTG AGCAAGGACG GGCTGGTGAG GCACTTCTTC CACCGGCCGT CGAAGGCGTA
CACGACGGGG ACGAGGAAGC GGCGGAAGGT GCACAGCGAC GAGGTCGACG GCGGCGAGAC GCGGTGGCAC AAGACCGGCA
AGACGAGACC GGTGATGGCC AACGGCCGGC CCAGGGGCTA CAAGAAGATC CTCGTCCTCT ACACCAACTA CGGCAAGCAG
CGCAAGCCGG AGAAGACCAA CTGGGTGATG CACCAGTACC ACCTCGGCTC CGACGAGGAG GAGCGGGACG GCGAGCTCGT
CGTCTCCAAG GTCTTCTTCC AGACGCAGCC CAGGCAGTGC GGCTCCACCG CCGCCGCCGC CGCCGCCAAG GAGGCCTCCG
CCGCCGTCGC CGCCGCCGTG GTGAACAGCA ACTACTCCAT CGTCCATGGC CATCAAGGTG GTGGTGGTGG TAGCTTTCTC
AAGGAGGCAA ACGTTGTGCA CGAGTTCTAC GACCCGGCAG CAACGATGGG TTACCGGCCA CCTGCTCCTG CTGCGCACTT
CGCGCCAAAC TTCGCGGTGC ACGCGGCAAG GAACAGCTTT GGTGGCCCTT GAAGGAAAAA CCAAAATTAC ACAAAATCTA
AACATTACCG TTTATACCGA TATGATTCAC ATAGGTGCCA TTATATTACA TTCTTAACCT TACATTCATC CATCAGTTAT
TTGCAGTTTT GTTCAAAGTT GTTATATCGT TTCCGATGCT ATACTGTGCA AAGATTATTA CTACACGCCG TTCTAACTCG
AAAATGTCAA TTAATGTATC AGTTTGTACA TGTATACATG CACACGGAAG AGGTCCTGAT GATGCATCAC TTCAT

Locus: Os05g0563000

Loading...

Locus: Os05g0563000

Loading...