Os05t0566400-01

Locus

Os05g0566400

Description

Group D mitogen-activated protein kinase (MAPK), Defense responses to BPH, Control of excessive defense responses, Protection from defense-response-related autotoxicity

RAP-DB Gene Symbol Synonym(s)

OsMAPK20-5

RAP-DB Gene Name Synonym(s)

mitogen-activated protein kinase 20-5

CGSNL Gene Symbol

MPK7

CGSNL Gene Name

MITOGEN-ACTIVATED PROTEIN KINASE 7

Oryzabase Gene Symbol Synonym(s)

OsMPK7, OsMAPK44, MAPK44, OsMAPK20-5, MAPK20-5

Oryzabase Gene Name Synonym(s)

mitogen-activated protein kinase 7

Transcript Evidence

AK099472

AK061645

AK100389

Protein Evidence

Q0DFW7

Literature

PMID: 30602493

Note

Manual Curation

April 8, 2019

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Protein kinase, ATP binding site (IPR017441)

Mitogen-activated protein (MAP) kinase, conserved site (IPR003527)

Full-length cDNA

J013024B05 (Online Clone Ordering)

001-036-B07 (Online Clone Ordering)

J023085N24 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0566400-01)

RiceXPro (AK099472)

Others

Oryzabase (10238)

KEGG (Os05t0566400-01)

Transcript

2363 bp

>Os05t0566400-01 Group D mitogen-activated protein kinase (MAPK), Defense responses to BPH, Control of excessive defense responses, Protection from defense-response-related autotoxicity
GCACCGCTACACTACTCGGCTCGGCTGCTTCTTCTTCTCCTTCTCCTCATCCTCCACATC
GCTGCGGATTCGAGCGGCGAGGCTTGGATTTTCTCCCGGCGAGATCTCCCCGGCGGCCGT
CTCGCGATGCCTGAGGCAAATGCGGGTGGGCGGGCGGCGCCGGCGGCGGAGCAGCGGAGC
AAGAACACAACAGAGATGGATTTCTTCAGTGAATATGGTGACTCCAGCCGATACAAAATT
CAAGAAATCGTTGGTAAAGGAAGTTATGGAGTTGTTTGTTCAGCTATTGACCAACATACC
GGTGACAAAGTAGCAATCAAGAAAATACACAATATCTTTGAGCATCTATCTGATGCTGCT
AGGATCCTCCGTGAGATCAAACTTCTCCGGCTTTTACGGCATCCTGATATTGTCGAGATC
AAACATATAATGTTACCTCCATCTAGAAGGGACTTCAAAGATATTTATGTTGTCTTCGAA
CTGATGGATACAGACCTCCACCAGGTTATTAAGGCTAATGATGACTTAACGAAGGAACAT
CATCAGTTCTTTCTGTATCAAATGCTTCGAGCATTGAAATATATCCATACTGCTAATGTT
TATCATCGTGATTTAAAGCCCAAAAATATATTAGCAAATGCTAACTGTAAGCTCAAGATA
TGTGATTTTGGACTAGCAAGAGTTGCATTTAATGACACTCCTACAACAGTTTTCTGGACG
GACTACGTTGCAACTAGATGGTACAGGGCTCCTGAGCTGTGTGGGTCTTTCTTTTCTAAG
TATTCACCAGCTATAGATACATGGAGTATTGGTTGCATTTTTGCGGAGATTTTGACTGGA
AAACCTTTGTTCCCTGGTAAAAATGTGGTTCATCAATTGGACTTGATGACTGATCTCTTG
GGTACACCATCAATGGATGCTATTTCAAGGATTCGGAATGACAAGGCAAGGAGGTATCTG
AGCAGCATGAGGAGGAAGCAGCCAGTACCTTTTTCAGAAAAGTTCCCAAATGTAGATCCT
TTGGCACTCAAGCTCTTACAAAGGCTTCTAGCATTTGATCCGAAGGATCGACCTACTGCA
GAAGAGGCgttggctgatccatattttaaaggccttgcaaaagtggagagagaaccatca
tgccaaccaatttcaaaaatggagtttgagtttgagcgaagaaaggttaccaaagatgat
atcaaggaacttatattccgtgagatattagagtatcatcctcagcttctgaaggattac
atgaatggctccgaaaacacgagctttctatatccaagTGCTGTTGATAATTTCCGGAGG
CAATTTGCCATCTTAGAGGAAAACGGAGGAAAGAGTGGTGCACTAGATAGGAAGCATGTT
TCTCTTCCAAGGGCTACAACAGTTCACTCTACATCAATTCCTCCAAATGAAGGCCTAGAT
GCAACATCCCAAGTTACTCAAAGGATCCCAACAGCTAGACCAGGAAGAACGGTTGGTCCG
GTATTACCATTCGAGAATCCAGGCGCCGCAGATCCGCACAGCGCACGGAGGGTGGTGAGG
AATCCGATGGTTCCTCCAGCAGCTGCCAACAAGTCAGGATACAGCTACAACCTAAAGTCA
GACTACTCTGATAGGCAACATCAGGAAGAGCTTGAGAAAGATCGTGTGCAGTACAGGCCT
GCACAACACTTGATGGATGCTAAAGTTGCTCCAGATACAGCCCCGGACATACGGTCTTCA
CAATACTACTTTACGAGGAGTGCTCCCAGAACTGATCTAACAGACAGGGCTGCACTCCAG
GGGAGCATGCTATACGGCATTGCTCCGTTCAACGGCATCGCAGCAGTTGCTGGTGGATAC
AGCAAGGTTGGTGCCGTTCAATATGGTGTTTCAAGGATGTACTAGAGTTTTAGTCAGGCA
GTTGTGGAATTGCTCCATAGATGAGCAAGATGGGAATGCCGGAGCATGGCTTTGTGTTGT
GCCCATCCACCCAGATATAAGGCTGGCAAGGGAATTGGTCGCATCTGGTCATGGATGCAG
GCGAAGGTTGAAGAAAGGAGAAGGGAAACTCCTATTCCATCTCAGGCGGCCATTGTCCAT
TTGAAATGGCAGTGAGCTCGCGATGGTGAAAGAGGAAAAGAGGGAGAGAAAGTTCATGGT
GGAATTTCTCGCACTTTATTTGTTGTGGAGAAAAGGAGAAAATGTGAATAACAGCACTAG
GCTGGGCTTGTGTACATACCTGCAACCCTTGATTTTTTTTTCTTGTTTTCTTGCTAGAAG
CTGTTGCTTCTTGTGTAAACCTGCAAAAGCATACTCCGAAAATGAATCATTCGCCAAAAA
ATTGAGACGGCGGATTATTTGGT

CDS

1779 bp

>Os05t0566400-01 Group D mitogen-activated protein kinase (MAPK), Defense responses to BPH, Control of excessive defense responses, Protection from defense-response-related autotoxicity
ATGCCTGAGGCAAATGCGGGTGGGCGGGCGGCGCCGGCGGCGGAGCAGCGGAGCAAGAAC
ACAACAGAGATGGATTTCTTCAGTGAATATGGTGACTCCAGCCGATACAAAATTCAAGAA
ATCGTTGGTAAAGGAAGTTATGGAGTTGTTTGTTCAGCTATTGACCAACATACCGGTGAC
AAAGTAGCAATCAAGAAAATACACAATATCTTTGAGCATCTATCTGATGCTGCTAGGATC
CTCCGTGAGATCAAACTTCTCCGGCTTTTACGGCATCCTGATATTGTCGAGATCAAACAT
ATAATGTTACCTCCATCTAGAAGGGACTTCAAAGATATTTATGTTGTCTTCGAACTGATG
GATACAGACCTCCACCAGGTTATTAAGGCTAATGATGACTTAACGAAGGAACATCATCAG
TTCTTTCTGTATCAAATGCTTCGAGCATTGAAATATATCCATACTGCTAATGTTTATCAT
CGTGATTTAAAGCCCAAAAATATATTAGCAAATGCTAACTGTAAGCTCAAGATATGTGAT
TTTGGACTAGCAAGAGTTGCATTTAATGACACTCCTACAACAGTTTTCTGGACGGACTAC
GTTGCAACTAGATGGTACAGGGCTCCTGAGCTGTGTGGGTCTTTCTTTTCTAAGTATTCA
CCAGCTATAGATACATGGAGTATTGGTTGCATTTTTGCGGAGATTTTGACTGGAAAACCT
TTGTTCCCTGGTAAAAATGTGGTTCATCAATTGGACTTGATGACTGATCTCTTGGGTACA
CCATCAATGGATGCTATTTCAAGGATTCGGAATGACAAGGCAAGGAGGTATCTGAGCAGC
ATGAGGAGGAAGCAGCCAGTACCTTTTTCAGAAAAGTTCCCAAATGTAGATCCTTTGGCA
CTCAAGCTCTTACAAAGGCTTCTAGCATTTGATCCGAAGGATCGACCTACTGCAGAAGAG
GCgttggctgatccatattttaaaggccttgcaaaagtggagagagaaccatcatgccaa
ccaatttcaaaaatggagtttgagtttgagcgaagaaaggttaccaaagatgatatcaag
gaacttatattccgtgagatattagagtatcatcctcagcttctgaaggattacatgaat
ggctccgaaaacacgagctttctatatccaagTGCTGTTGATAATTTCCGGAGGCAATTT
GCCATCTTAGAGGAAAACGGAGGAAAGAGTGGTGCACTAGATAGGAAGCATGTTTCTCTT
CCAAGGGCTACAACAGTTCACTCTACATCAATTCCTCCAAATGAAGGCCTAGATGCAACA
TCCCAAGTTACTCAAAGGATCCCAACAGCTAGACCAGGAAGAACGGTTGGTCCGGTATTA
CCATTCGAGAATCCAGGCGCCGCAGATCCGCACAGCGCACGGAGGGTGGTGAGGAATCCG
ATGGTTCCTCCAGCAGCTGCCAACAAGTCAGGATACAGCTACAACCTAAAGTCAGACTAC
TCTGATAGGCAACATCAGGAAGAGCTTGAGAAAGATCGTGTGCAGTACAGGCCTGCACAA
CACTTGATGGATGCTAAAGTTGCTCCAGATACAGCCCCGGACATACGGTCTTCACAATAC
TACTTTACGAGGAGTGCTCCCAGAACTGATCTAACAGACAGGGCTGCACTCCAGGGGAGC
ATGCTATACGGCATTGCTCCGTTCAACGGCATCGCAGCAGTTGCTGGTGGATACAGCAAG
GTTGGTGCCGTTCAATATGGTGTTTCAAGGATGTACTAG

Protein

592 aa

>Os05t0566400-01 Group D mitogen-activated protein kinase (MAPK), Defense responses to BPH, Control of excessive defense responses, Protection from defense-response-related autotoxicity
MPEANAGGRAAPAAEQRSKNTTEMDFFSEYGDSSRYKIQEIVGKGSYGVVCSAIDQHTGD
KVAIKKIHNIFEHLSDAARILREIKLLRLLRHPDIVEIKHIMLPPSRRDFKDIYVVFELM
DTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTANVYHRDLKPKNILANANCKLKICD
FGLARVAFNDTPTTVFWTDYVATRWYRAPELCGSFFSKYSPAIDTWSIGCIFAEILTGKP
LFPGKNVVHQLDLMTDLLGTPSMDAISRIRNDKARRYLSSMRRKQPVPFSEKFPNVDPLA
LKLLQRLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPISKMEFEFERRKVTKDDIK
ELIFREILEYHPQLLKDYMNGSENTSFLYPSAVDNFRRQFAILEENGGKSGALDRKHVSL
PRATTVHSTSIPPNEGLDATSQVTQRIPTARPGRTVGPVLPFENPGAADPHSARRVVRNP
MVPPAAANKSGYSYNLKSDYSDRQHQEELEKDRVQYRPAQHLMDAKVAPDTAPDIRSSQY
YFTRSAPRTDLTDRAALQGSMLYGIAPFNGIAAVAGGYSKVGAVQYGVSRMY*

5'UTR

chr05:28193897..28194022 (- strand) : 126 bp

CDS

chr05:28193840..28193896 (- strand) : 57 bp

chr05:28192334..28192742 (- strand) : 409 bp

chr05:28191695..28191822 (- strand) : 128 bp

chr05:28191521..28191580 (- strand) : 60 bp

chr05:28190930..28191079 (- strand) : 150 bp

chr05:28190677..28190834 (- strand) : 158 bp

chr05:28190338..28190547 (- strand) : 210 bp

chr05:28190167..28190259 (- strand) : 93 bp

chr05:28189884..28189966 (- strand) : 83 bp

chr05:28189352..28189782 (- strand) : 431 bp

3'UTR

chr05:28188894..28189351 (- strand) : 458 bp

FASTA

>Os05t0566400-01 class=Sequence position=chr05:28188894..28194022 (- strand)
GCACCGCTAC ACTACTCGGC TCGGCTGCTT CTTCTTCTCC TTCTCCTCAT CCTCCACATC GCTGCGGATT CGAGCGGCGA
GGCTTGGATT TTCTCCCGGC GAGATCTCCC CGGCGGCCGT CTCGCGATGC CTGAGGCAAA TGCGGGTGGG CGGGCGGCGC
CGGCGGCGGA GCAGCGGAGC AAGGTGGGTG GTGGCCGTGG GAGAACACTA AAGATTTCGC TGCTGCTTCG TTTTGTTTCT
CTGGGTTCTT GGGGTTCGTC GCCGTGTTCA TCTGAACTTG GATAGGCTGG ACGAATTGGT GTTTTTTTTT GTTTTTTTTG
GGGGATTGTG GGTtctgatc cgaagaagtt tggtgtcctg ctcctgcgcg tgagcgtaaa cggcgtcagg aaattgctcc
cggatttgga gcggattctt gccttgtagg aagatcctat cctatcatat cctatcctac ctgagctttg cgagcgtttc
ctgaaatctt tcctgtgcat ctgcaagaag ccatttatct ctttccttaa aacgtagtct cctactacaa ggctgattga
cttgtataaa cgctactatt agcccgtaat aacacggtaa ttcttgtttg gttcaaaatc ttggggtaat gggtaAGTTT
ATCCTAATCC AAGCAAGCTG TATTTTCTTT CCGGGATATA GCACTGTAGA TATCTTTGCC CACTTAAAAA AAAGGAGGTA
TATTTTTACT TATAGGTTTG AGCCAAAGGT GTATCTTTTC CAGACTGATC ATTAGACTTG TCAAGAATTA GGGCGATCAT
TAGTTCACCA CAGCGGGAGC CGGGAGTAGA GGTCAGGTCA GTTTTTGTTT GGTCAGGCTG CAGTGTATCT GTATGTTTCT
GTAATCCGGT TCTGTGAATT ACTTGTTGCA GACCTTCAGT CTGTGGTTTC CAGTCGTCGA GCATAGACTA GGCAAAGGTT
ACTGTTTCAT TGGTTTTTGT TTTTGCCTTT TTGGTTGTGA TGTCTTTGGT GCAAGGAGTA TTATTAGGAG TTCAATTGCA
AGCTGTATGT AATTGGTTAA CTTTTTTTTT TTGGCAAAGC TTCTTAGTAT CCCGATAATG CGAAACCCTT GGTTTTGTGA
TTAGTTGTGT TGCAGCTGCT TAGCTCTTGG GGAAGATGTA ACTCAGTGAA TTTGTGCTTT GTTCCAATTC ACATGCCATT
GCCTAAATTA TGTAATTGTT CTTGGATGCC ATTGTGTTTT GAGACAGAGT GCTGAATTTT CAATCTTGAA TTTTGTCCAG
AACACAACAG AGATGGATTT CTTCAGTGAA TATGGTGACT CCAGCCGATA CAAAATTCAA GAAATCGTTG GTAAAGGAAG
TTATGGAGTT GTTTGTTCAG CTATTGACCA ACATACCGGT GACAAAGTAG CAATCAAGAA AATACACAAT ATCTTTGAGC
ATCTATCTGA TGCTGCTAGG ATCCTCCGTG AGATCAAACT TCTCCGGCTT TTACGGCATC CTGATATTGT CGAGATCAAA
CATATAATGT TACCTCCATC TAGAAGGGAC TTCAAAGATA TTTATGTTGT CTTCGAACTG ATGGATACAG ACCTCCACCA
GGTTATTAAG GCTAATGATG ACTTAACGAA GGAACATCAT CAGTTCTTTC TGTATCAAAT GCTTCGAGCA TTGAAATATA
TCCATACTGG TAAGCATATT ATGAAATCTT ACCTACCCTC TGAAAGTTCT TCTATCATGG TATCACATTG GAGCTTCTCT
GAGTTAGGAT TATGAGCAAT TCTAAGTAGT GCATTTGCAC AAAAAGTTAC AGTTTTCTAT TAAGCAATGC GATAGTCTTA
GTCTTATTGT CCTGTGCATT CTTGAAGTAG CAGTCGAAAT TTTCCTAGTG CCATTTCTTC TGTCTTGTCT GTATGGTGTT
AACCATGATT CTATTGATTT CCCAAGATAG CTGTGAGGTT CAGATTATAT AGAGCTCTTC TCTTTGTATT GAAATTTCTT
TGACATAAGT GCCAATTGCC AAAAATGTGC TCTCAATTCA ATAGCTATCA AGTCGTGTTC AGTTCAGAAA GTCTTCTGTT
GTATGAATCC TGTTCAAATT CTGTCTTTGG ATCTGCTAGC TGCAGTAACT AAATTTATTA TATCTCAATT GAGCATTGAG
TATTTATCTA TGTTCTGATG AGAAGTCTTT GTGGGTGCAG CTAATGTTTA TCATCGTGAT TTAAAGCCCA AAAATATATT
AGCAAATGCT AACTGTAAGC TCAAGATATG TGATTTTGGA CTAGCAAGAG TTGCATTTAA TGACACTCCT ACAACAGTTT
TCTGGACGGT ATGTTATTTT CAACACTAAG TTCTCTATGG AAAACTAGAT GCCATGTCGT GTTCCATACC AAAGAATTTG
TCATGCAACA TAAGTCTCAC TGTCTGCTTC ACCATGCAAC AGGACTACGT TGCAACTAGA TGGTACAGGG CTCCTGAGCT
GTGTGGGTCT TTCTTTTCTA AGGTATAATC AAATTTCCCA ACCTGTGGGT TGCTTTATCA GAGTATTATT TCGTGTGCTC
TTCATTTTCA TAGGGCTCTA CAGCATAAGA AATTTTAGCA ACATGTTCCA ATTTCTTCTT CTTATCTATT GAAATTGACC
TTGAGATGCC ACACACATAC ACATAAAGAG CAATAAAATT AAGGACTGAG ATTCTACATG GTTGGTGCGT AGGTCAGTGT
CCTTCTTTGG TTATTATATG TCAGTTAGTT TTAGAGTAGT GTAGCAGCAT ATTAATAGCA GGCTGCTTGT TCAGGAACAT
ATTTTTGACA AGCCAAAATA CACTGCTTAA TGTTGCAGGT ACTCCTGTAA AATCTGCTGT AGTTGTTTTT TGTTATCCCT
ACCTTCATTT TTACCTCCAT TCCTATGCTA AGTTGGTGAT ACTAAATTGA TTCTTTTCTG CAGTATTCAC CAGCTATAGA
TACATGGAGT ATTGGTTGCA TTTTTGCGGA GATTTTGACT GGAAAACCTT TGTTCCCTGG TAAAAATGTG GTTCATCAAT
TGGACTTGAT GACTGATCTC TTGGGTACAC CATCAATGGA TGCTATTTCA AGGGTATGAC TTATTATTAT TATCAGAAAC
ATTGACATGT TTAATTCTCC AGCACAAATT ATTCCAGGTC TGATTTTTCC ATGTTTTGAC TGCTTCAGAT TCGGAATGAC
AAGGCAAGGA GGTATCTGAG CAGCATGAGG AGGAAGCAGC CAGTACCTTT TTCAGAAAAG TTCCCAAATG TAGATCCTTT
GGCACTCAAG CTCTTACAAA GGCTTCTAGC ATTTGATCCG AAGGATCGAC CTACTGCAGA AGAGGCATGC AAGCTCTACT
TGAATTAGAT TAGTTTTCAT GCTACTGTTT TGCATTGTCA TCTGTGCTAC TAAACATAGT TATATATGCC TACTTTAGAT
GTTATTCTAA CAATCTATTt tgtgtataat caggcgttgg ctgatccata ttttaaaggc cttgcaaaag tggagagaga
accatcatgc caaccaattt caaaaatgga gtttgagttt gagcgaagaa aggttaccaa agatgatatc aaggaactta
tattccgtga gatattagag tatcatcctc agcttctgaa ggattacatg aatggctccg aaaacacgag ctttctatat
ccaaggtttt tatcttgACA CATCTTATAA ATTATTTCCC TGTTTATATG GTTATATTCA CAACCTTTAT TTTTGTTATG
TAGTGCTGTT GATAATTTCC GGAGGCAATT TGCCATCTTA GAGGAAAACG GAGGAAAGAG TGGTGCACTA GATAGGAAGC
ATGTTTCTCT TCCAAGGTAA CTTACATCGT TACAGTTCTT TCCAATGTGA TCATAATTGC CAATTCAGTG ATTTGTGCTG
CCATCTATTG CATCTGTTAA AATTAATACA CAAGGGAAGA AAAAATGTTT TACCATTAGT ATTGGGTTAT CTTGGCTGTC
AGATCCTAGA TATTGTGCTT GAACTTTGCA GCTGACCTTT GATCGGCTCT TTGCAGGGCT ACAACAGTTC ACTCTACATC
AATTCCTCCA AATGAAGGCC TAGATGCAAC ATCCCAAGTT ACTCAAAGGA TCCCAACAGG TATCTGTTTA TCTTTACCAT
TTGTGACTTA ATCCAGTGTA CATTTTAATT TTGAATTCAA AGAGCATTGA TCTCATATAT TTCATCTTTG TCACTCACAG
CTAGACCAGG AAGAACGGTT GGTCCGGTAT TACCATTCGA GAATCCAGGC GCCGCAGATC CGCACAGCGC ACGGAGGGTG
GTGAGGAATC CGATGGTTCC TCCAGCAGCT GCCAACAAGT CAGGATACAG CTACAACCTA AAGTCAGACT ACTCTGATAG
GCAACATCAG GAAGAGCTTG AGAAAGATCG TGTGCAGTAC AGGCCTGCAC AACACTTGAT GGATGCTAAA GTTGCTCCAG
ATACAGCCCC GGACATACGG TCTTCACAAT ACTACTTTAC GAGGAGTGCT CCCAGAACTG ATCTAACAGA CAGGGCTGCA
CTCCAGGGGA GCATGCTATA CGGCATTGCT CCGTTCAACG GCATCGCAGC AGTTGCTGGT GGATACAGCA AGGTTGGTGC
CGTTCAATAT GGTGTTTCAA GGATGTACTA GAGTTTTAGT CAGGCAGTTG TGGAATTGCT CCATAGATGA GCAAGATGGG
AATGCCGGAG CATGGCTTTG TGTTGTGCCC ATCCACCCAG ATATAAGGCT GGCAAGGGAA TTGGTCGCAT CTGGTCATGG
ATGCAGGCGA AGGTTGAAGA AAGGAGAAGG GAAACTCCTA TTCCATCTCA GGCGGCCATT GTCCATTTGA AATGGCAGTG
AGCTCGCGAT GGTGAAAGAG GAAAAGAGGG AGAGAAAGTT CATGGTGGAA TTTCTCGCAC TTTATTTGTT GTGGAGAAAA
GGAGAAAATG TGAATAACAG CACTAGGCTG GGCTTGTGTA CATACCTGCA ACCCTTGATT TTTTTTTCTT GTTTTCTTGC
TAGAAGCTGT TGCTTCTTGT GTAAACCTGC AAAAGCATAC TCCGAAAATG AATCATTCGC CAAAAAATTG AGACGGCGGA
TTATTTGGT

Locus: Os05g0566400

Loading...

Locus: Os05g0566400

Loading...