Os05t0571000-01

Locus

Os05g0571000

Description

WD40 repeat-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-123, OsSPA1

Oryzabase Gene Name Synonym(s)

SPA1-like

Transcript Evidence

AK111749 (DDBJ, Best hit)

Protein Evidence

B8AWT9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

WD40 repeat (IPR001680)

Protein kinase-like domain (IPR011009)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

G-protein beta WD-40 repeat (IPR020472)

Full-length cDNA

J023054J06 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0571000-01)

RiceXPro (AK111749)

Others

Oryzabase (10804)

KEGG (Os05t0571000-01)

Transcript

4351 bp

>Os05t0571000-01 WD40 repeat-like domain containing protein.
TTTAATCCTCTCCCCCTTCTTCCTCGTCCCTCTGCTGCTGCCGCTGCTGCTTCTCCCCCT
TCCTTCTGTGCCACACACTCGCGAGGAGAGGAGAGAAGAGGAGGAGGCGAAGAAAAAAAA
AACCTAAGCGCTTTTCCCTTTCGGGAAATTCCGCGCGCTCGCCTCCCCCGCCGCGGCGCC
ACCGCCGCCGCCCCCGCCGCGGATTCGCCGCCTTCCTCAGGCGGCGCAGCGTGCCGCGCA
GGCGTCGTCGTCTCGGTAATCGCGCGAGGGGTCGTGGTCGCTCTGGGATGGGGTTGTGGC
GCTGAGATGGTGGTGGGCGGCGCGAGGTTGTGTTCGCCGTGAGGTATGGTTCCCAACCGC
TGAAATTTGGGGGGGCGCGGAGGATGGTCCGGCGAGGGGTGATCTCATTGCGAGCAGGAT
GGCGGGGACGCATGGTTTTCGTAGGGTAGGCGTGGTCGAGATGGAAGCGGCGACGGCGGC
TGAGGTGGCCGGTGCCGGCAGCGGCACGGATGGCGATTTGCAGATTAAAGGCAGCAAGGA
GAATGGTCAGACTGCGGAGCAGCCGGCGGCCAGCGAGGCGCTTGAGATGCCCTCCACTCC
GCTCCCGCTCCCGAGGGACATAGATTGGTCGGAGCATTTCTCCTTCTTCAATTCGGTGGG
CGGGTTTGGGGGCAGCATGGATGGCGCGAGGGGCTTGACTAGTGTTGGCCTATCTAATTC
TGAGTCGAGGCCGGATAGTGTAACCCAGATCCAGAGCTGTTTGAACAATGCAGACGAGAG
GGTTGAGGAGCTCACATTGAAAAATTGCATCAGCTCCGATGCGCAACATGAGGTTTCAGC
TGGTGGAAGCACGAGCAGCGGGGAGAAGCCTACAGTTATGAGGGGTCTGTGGGGTAATTT
TACAAGGATGTCATGGAGAGCTAGCGACGTGGCTAACAGGGAAAAATTAGCAGCGAATCG
TGGTGACGTTGCAAACTTGAGGGTCGGTGACATGCCCATCAGGGAAAATTTGGCGGTGAG
CTTCGGCAACAATATGATCTCACGAAATGATGCATCCAACAAGGAAATGGGAATGAGCCA
TGGGGATCATGCGAATAACGAGTTCAATTTGCCGTTTGGTAATCAGCAGCCTTTTCTGTC
TCCACGGCCTAATCAGAATGAGCAGCGAGTTGAAAGGGAGAATGCTCTCATAGTGAGTAG
CTTTTCAGCTAGAATTCTGGATCAGATGAGGAGTAAGAATGTAACACCTTCGTCTGGGGT
TCAGAGCTTCCCATTTAAGAGTGTGTTGAAGGGTAAAGGTGTTGTATATCAAGGTGCACG
AGAGGAGATCCAAGTTCAAGGTAATGCAAGGACCAGAGCCCCTATGGATAAGATTCGCAA
GATCCCTAACATACCACAGGATTCCATGGCTAGAATGGATGGTACAATCTTTGGCAGTGG
TGGAAATGTTTTAGAACCACAGTGCGAGGGAACCAGCCTAAGGGAACTAATTAAGCCTGC
ACGCCAAACAATGAGCAAGTTTGAGAAAATGCACTTCTTTAAGCAGATTCTTGATCTCGT
AGACAAATCTCATGCCCAGGGTTTTAGTTTACAGCATTTGCGCCCATCATACTTTACTAT
CTCAGCCTCAAACCAAGTAAAATATATTGGTTCTTATGGTACCCAAGATTTATCAGCCCC
AAGCAAACTGGATATTGCGACGGATGATATTTTCAATACAAAAAGATACCTTGATCCCAA
AGTTGAGTCCCAAGATTCTAATGGCGATAATGCTTCAATCACAAAGTATCAAAAAGTTGG
TGAACAAGGATCCATTGCTGTAAGGCGACCAGTGCATACCTTTTGGGCTAATCACAGAGG
GGGCAACCAAAGTGAAGGTGTTGATCCTGGTGCTTTGTGGCAGGGCAATTCGAGCTGCAC
TGTCCGAGAACGTTTTAAGGCTGCAGAACCTTTCTATGGTGGCAGTATGCCCTATGCTCA
ACGACCATCAAGTTCTGGCAACCAACAGTCAGTATTTGAATTGAGGATGCTGGAGGAAAG
CTGGTACAGAAGTCCAGAAGAGATCAGTCAGTTGAAAGGCATACTTCCATCAAACATCTA
CAGCCTTGGGGTTCTTTTGTTTGAGCTCTTTTGCTGCTGTGAAACATGGGAGGTACATTG
TGCTGCAATGTCAGATCTCCGTCATCGCATTTTGCCCCCAAATTTTCTTTCAGAAAGTCC
TAAAGAAGCTGGTTTCTGTCTTTGGTTACTCCATCCAGATCCCTGTTCTCGGCCTAAGGC
AAGAGATATTCTAGGGTGTGACTTGATAAATGAGGGTCGAGATTTGTCCTTGTTAGATAA
TAAAACACCAGTTGCTGTCAATGAAGAAGACACCGAATCTGGTTTGCTACTGGGCTTCCT
TTCTCAACTCAAGGAAGAAAAGGAGATGCACGCTGCCAAATTGTCAGCTGATCTTGCGAG
CTTGGAAACAGATATCGCAGAGGTTGAGAAAAGACACTCAATGAGGATGGGATTTAGTTT
AGAGGACATGGATGTACTGGCAGGTTCTAATGATCTCTCAGGAGCTTCTGCATGTGCCCT
GGGAGGTGCATCACTCTCAGGTTTGCCACCATCTTTGTGCAGATCGAGCATATATGAGGA
GCGGGTCATGAGAAACTTGGAGCAGCTTGAAAATGCATATTACTCCATGAGGTCCACCAT
TGACACATCGGAGGCCAATATAATTAAACGAGTTGATAATGATGCTTTAAGGGTTCGTCA
AAATTTTCACGAGCTGCATAGTGATGCTAATGCTATCGATGAGCAAGCAGACCCCCTTGG
ATGGTTTTTCGATGGCTTATGCAAGTATGCCCGGTATAGTAGGTTTGAAGTACGGGGAAT
TCTGAAGAATGCAGATATACTTAACTCACCAAATGTGATTTGTTCGTTAAGTTTTGATCG
GGATGAAGAATATTTTGCTGCTGCTGGTGTTTCAAAGAAAATTAAAATATTTGAATTTGA
TGCCCTTTTAAATGATCGTGTTGATATTCATTACCCATTGATAGAGATGCCTAGCAAATC
CAAGCTTAGCTGTGTCTGTTGGAACAGCTACATAAAAAATTACTTGGCATCAACAGACTA
CGATGGCACTGTTCAGTTGTGGGATGCAAGCTCGGGTCAAGGATTCACGCAGTTTACGGA
GCACCGAAAAAGAGCTTGGTCTGTAAGTTTCTCAGAGGTGGATCCAACTAAATTGGCAAG
TGGAAGTGATGATTGCTGCGTGAAAGTTTGGAGTATTAACCAGAAAAATTGCACTGATAC
CATCAGAAACGTGGCCAACGTGTGCTGTGTACAGTTCTCCCCATACTCCTCTCGTATGTT
AGCTTTTGGCTCGGCTGATTATAAGATATACTGTTATGATCTGAGGAATACAAGAATCCC
ATGGTGTACTATTTCTGGGCATGGAAAAGCTGTCAGCTATGTACGATTCTTGGATCCAGA
AACACTTATCTCTGCATCAACTGATAACACCTTGAAAATATGGGATCTCAACCAGACTAA
TTCCAGTGGATTATCTACTGATGCCTGCAGTATGACGTTGAGTGGCCATACCAATGAGAA
GAATTTTGTGGGGTTATCTGTTCACGATGGATACATAACTTGTGGTTCTGAAAATAATGA
AGTATTTTCTTATTACAAAACCTTTCCCATGCCAATAACTTCTCACAAGTTCGGTTCAAT
CGACCCAATAACTGGACAAGAGACAAATGATGATAACCAACAATTTGTGTCCAGTGTTTG
CTGGCGAGGGAGGTCGAACATGGTAGTGGCTGCCAATTCTACTGGCAGCATTAAAGTGCT
TGAGCTTGTGTGAATAAGTTGATGGGAACTTTAGTGAATGGGAAGATCTGAATCCTAAGG
TTGCCATACTGCATGGTTGATGCTTAGCTGCCCTTGTATATTTCCGTGAACGTCTGCCTT
CGCAGCAGGCAGCTACTCAAGCATCAACCATCCTTCGGTTCTGGGCTTCATTCCATCAGA
GCATTTGCAACACTCAGTTTACCCCATTCAAGCAACCTACAGCGCCAAACTATTGGTGGT
GAAGAGATCGGCGAACAAAGAGAACAAAGAGATCTTCGAAGGTATGAAAGGTACTGGCAA
TTCTTGAAGATGATTGCCACCACCAAAATATTTTGTTTGTATGGCGTTTTGACATAGTAC
AAGTCAGCATTTTAAGGAGGGCCTTAGGGGTCTGTACAGATTAGGGTCACAAAGGGTCGA
TGTAATATAATATATCATGAAATTGGATATGCTTTTGGGCTAAAAAGCCTTACATGATAC
ATCTACTCGAGAAATATCACTGGGAATTAAC

CDS

3435 bp

>Os05t0571000-01 WD40 repeat-like domain containing protein.
ATGGCGGGGACGCATGGTTTTCGTAGGGTAGGCGTGGTCGAGATGGAAGCGGCGACGGCG
GCTGAGGTGGCCGGTGCCGGCAGCGGCACGGATGGCGATTTGCAGATTAAAGGCAGCAAG
GAGAATGGTCAGACTGCGGAGCAGCCGGCGGCCAGCGAGGCGCTTGAGATGCCCTCCACT
CCGCTCCCGCTCCCGAGGGACATAGATTGGTCGGAGCATTTCTCCTTCTTCAATTCGGTG
GGCGGGTTTGGGGGCAGCATGGATGGCGCGAGGGGCTTGACTAGTGTTGGCCTATCTAAT
TCTGAGTCGAGGCCGGATAGTGTAACCCAGATCCAGAGCTGTTTGAACAATGCAGACGAG
AGGGTTGAGGAGCTCACATTGAAAAATTGCATCAGCTCCGATGCGCAACATGAGGTTTCA
GCTGGTGGAAGCACGAGCAGCGGGGAGAAGCCTACAGTTATGAGGGGTCTGTGGGGTAAT
TTTACAAGGATGTCATGGAGAGCTAGCGACGTGGCTAACAGGGAAAAATTAGCAGCGAAT
CGTGGTGACGTTGCAAACTTGAGGGTCGGTGACATGCCCATCAGGGAAAATTTGGCGGTG
AGCTTCGGCAACAATATGATCTCACGAAATGATGCATCCAACAAGGAAATGGGAATGAGC
CATGGGGATCATGCGAATAACGAGTTCAATTTGCCGTTTGGTAATCAGCAGCCTTTTCTG
TCTCCACGGCCTAATCAGAATGAGCAGCGAGTTGAAAGGGAGAATGCTCTCATAGTGAGT
AGCTTTTCAGCTAGAATTCTGGATCAGATGAGGAGTAAGAATGTAACACCTTCGTCTGGG
GTTCAGAGCTTCCCATTTAAGAGTGTGTTGAAGGGTAAAGGTGTTGTATATCAAGGTGCA
CGAGAGGAGATCCAAGTTCAAGGTAATGCAAGGACCAGAGCCCCTATGGATAAGATTCGC
AAGATCCCTAACATACCACAGGATTCCATGGCTAGAATGGATGGTACAATCTTTGGCAGT
GGTGGAAATGTTTTAGAACCACAGTGCGAGGGAACCAGCCTAAGGGAACTAATTAAGCCT
GCACGCCAAACAATGAGCAAGTTTGAGAAAATGCACTTCTTTAAGCAGATTCTTGATCTC
GTAGACAAATCTCATGCCCAGGGTTTTAGTTTACAGCATTTGCGCCCATCATACTTTACT
ATCTCAGCCTCAAACCAAGTAAAATATATTGGTTCTTATGGTACCCAAGATTTATCAGCC
CCAAGCAAACTGGATATTGCGACGGATGATATTTTCAATACAAAAAGATACCTTGATCCC
AAAGTTGAGTCCCAAGATTCTAATGGCGATAATGCTTCAATCACAAAGTATCAAAAAGTT
GGTGAACAAGGATCCATTGCTGTAAGGCGACCAGTGCATACCTTTTGGGCTAATCACAGA
GGGGGCAACCAAAGTGAAGGTGTTGATCCTGGTGCTTTGTGGCAGGGCAATTCGAGCTGC
ACTGTCCGAGAACGTTTTAAGGCTGCAGAACCTTTCTATGGTGGCAGTATGCCCTATGCT
CAACGACCATCAAGTTCTGGCAACCAACAGTCAGTATTTGAATTGAGGATGCTGGAGGAA
AGCTGGTACAGAAGTCCAGAAGAGATCAGTCAGTTGAAAGGCATACTTCCATCAAACATC
TACAGCCTTGGGGTTCTTTTGTTTGAGCTCTTTTGCTGCTGTGAAACATGGGAGGTACAT
TGTGCTGCAATGTCAGATCTCCGTCATCGCATTTTGCCCCCAAATTTTCTTTCAGAAAGT
CCTAAAGAAGCTGGTTTCTGTCTTTGGTTACTCCATCCAGATCCCTGTTCTCGGCCTAAG
GCAAGAGATATTCTAGGGTGTGACTTGATAAATGAGGGTCGAGATTTGTCCTTGTTAGAT
AATAAAACACCAGTTGCTGTCAATGAAGAAGACACCGAATCTGGTTTGCTACTGGGCTTC
CTTTCTCAACTCAAGGAAGAAAAGGAGATGCACGCTGCCAAATTGTCAGCTGATCTTGCG
AGCTTGGAAACAGATATCGCAGAGGTTGAGAAAAGACACTCAATGAGGATGGGATTTAGT
TTAGAGGACATGGATGTACTGGCAGGTTCTAATGATCTCTCAGGAGCTTCTGCATGTGCC
CTGGGAGGTGCATCACTCTCAGGTTTGCCACCATCTTTGTGCAGATCGAGCATATATGAG
GAGCGGGTCATGAGAAACTTGGAGCAGCTTGAAAATGCATATTACTCCATGAGGTCCACC
ATTGACACATCGGAGGCCAATATAATTAAACGAGTTGATAATGATGCTTTAAGGGTTCGT
CAAAATTTTCACGAGCTGCATAGTGATGCTAATGCTATCGATGAGCAAGCAGACCCCCTT
GGATGGTTTTTCGATGGCTTATGCAAGTATGCCCGGTATAGTAGGTTTGAAGTACGGGGA
ATTCTGAAGAATGCAGATATACTTAACTCACCAAATGTGATTTGTTCGTTAAGTTTTGAT
CGGGATGAAGAATATTTTGCTGCTGCTGGTGTTTCAAAGAAAATTAAAATATTTGAATTT
GATGCCCTTTTAAATGATCGTGTTGATATTCATTACCCATTGATAGAGATGCCTAGCAAA
TCCAAGCTTAGCTGTGTCTGTTGGAACAGCTACATAAAAAATTACTTGGCATCAACAGAC
TACGATGGCACTGTTCAGTTGTGGGATGCAAGCTCGGGTCAAGGATTCACGCAGTTTACG
GAGCACCGAAAAAGAGCTTGGTCTGTAAGTTTCTCAGAGGTGGATCCAACTAAATTGGCA
AGTGGAAGTGATGATTGCTGCGTGAAAGTTTGGAGTATTAACCAGAAAAATTGCACTGAT
ACCATCAGAAACGTGGCCAACGTGTGCTGTGTACAGTTCTCCCCATACTCCTCTCGTATG
TTAGCTTTTGGCTCGGCTGATTATAAGATATACTGTTATGATCTGAGGAATACAAGAATC
CCATGGTGTACTATTTCTGGGCATGGAAAAGCTGTCAGCTATGTACGATTCTTGGATCCA
GAAACACTTATCTCTGCATCAACTGATAACACCTTGAAAATATGGGATCTCAACCAGACT
AATTCCAGTGGATTATCTACTGATGCCTGCAGTATGACGTTGAGTGGCCATACCAATGAG
AAGAATTTTGTGGGGTTATCTGTTCACGATGGATACATAACTTGTGGTTCTGAAAATAAT
GAAGTATTTTCTTATTACAAAACCTTTCCCATGCCAATAACTTCTCACAAGTTCGGTTCA
ATCGACCCAATAACTGGACAAGAGACAAATGATGATAACCAACAATTTGTGTCCAGTGTT
TGCTGGCGAGGGAGGTCGAACATGGTAGTGGCTGCCAATTCTACTGGCAGCATTAAAGTG
CTTGAGCTTGTGTGA

Protein

1145 aa

>Os05t0571000-01 WD40 repeat-like domain containing protein.
MAGTHGFRRVGVVEMEAATAAEVAGAGSGTDGDLQIKGSKENGQTAEQPAASEALEMPST
PLPLPRDIDWSEHFSFFNSVGGFGGSMDGARGLTSVGLSNSESRPDSVTQIQSCLNNADE
RVEELTLKNCISSDAQHEVSAGGSTSSGEKPTVMRGLWGNFTRMSWRASDVANREKLAAN
RGDVANLRVGDMPIRENLAVSFGNNMISRNDASNKEMGMSHGDHANNEFNLPFGNQQPFL
SPRPNQNEQRVERENALIVSSFSARILDQMRSKNVTPSSGVQSFPFKSVLKGKGVVYQGA
REEIQVQGNARTRAPMDKIRKIPNIPQDSMARMDGTIFGSGGNVLEPQCEGTSLRELIKP
ARQTMSKFEKMHFFKQILDLVDKSHAQGFSLQHLRPSYFTISASNQVKYIGSYGTQDLSA
PSKLDIATDDIFNTKRYLDPKVESQDSNGDNASITKYQKVGEQGSIAVRRPVHTFWANHR
GGNQSEGVDPGALWQGNSSCTVRERFKAAEPFYGGSMPYAQRPSSSGNQQSVFELRMLEE
SWYRSPEEISQLKGILPSNIYSLGVLLFELFCCCETWEVHCAAMSDLRHRILPPNFLSES
PKEAGFCLWLLHPDPCSRPKARDILGCDLINEGRDLSLLDNKTPVAVNEEDTESGLLLGF
LSQLKEEKEMHAAKLSADLASLETDIAEVEKRHSMRMGFSLEDMDVLAGSNDLSGASACA
LGGASLSGLPPSLCRSSIYEERVMRNLEQLENAYYSMRSTIDTSEANIIKRVDNDALRVR
QNFHELHSDANAIDEQADPLGWFFDGLCKYARYSRFEVRGILKNADILNSPNVICSLSFD
RDEEYFAAAGVSKKIKIFEFDALLNDRVDIHYPLIEMPSKSKLSCVCWNSYIKNYLASTD
YDGTVQLWDASSGQGFTQFTEHRKRAWSVSFSEVDPTKLASGSDDCCVKVWSINQKNCTD
TIRNVANVCCVQFSPYSSRMLAFGSADYKIYCYDLRNTRIPWCTISGHGKAVSYVRFLDP
ETLISASTDNTLKIWDLNQTNSSGLSTDACSMTLSGHTNEKNFVGLSVHDGYITCGSENN
EVFSYYKTFPMPITSHKFGSIDPITGQETNDDNQQFVSSVCWRGRSNMVVAANSTGSIKV
LELV*

5'UTR

chr05:28452677..28452931 (- strand) : 255 bp

chr05:28452424..28452586 (- strand) : 163 bp

CDS

chr05:28450717..28452423 (- strand) : 1707 bp

chr05:28449891..28450048 (- strand) : 158 bp

chr05:28448490..28449342 (- strand) : 853 bp

chr05:28447412..28447558 (- strand) : 147 bp

chr05:28446476..28446793 (- strand) : 318 bp

chr05:28446335..28446394 (- strand) : 60 bp

chr05:28445722..28445913 (- strand) : 192 bp

3'UTR

chr05:28445224..28445721 (- strand) : 498 bp

FASTA

>Os05t0571000-01 class=Sequence position=chr05:28445224..28452931 (- strand)
TTTAATCCTC TCCCCCTTCT TCCTCGTCCC TCTGCTGCTG CCGCTGCTGC TTCTCCCCCT TCCTTCTGTG CCACACACTC
GCGAGGAGAG GAGAGAAGAG GAGGAGGCGA AGAAAAAAAA AACCTAAGCG CTTTTCCCTT TCGGGAAATT CCGCGCGCTC
GCCTCCCCCG CCGCGGCGCC ACCGCCGCCG CCCCCGCCGC GGATTCGCCG CCTTCCTCAG GCGGCGCAGC GTGCCGCGCA
GGCGTCGTCG TCTCGGTAAC GTGTGGCTCT AATTCGTTTT TTTTTTTGGG TAGGAATGTC GCTGTTAGGG GTCGACGAGT
TCTAATCCGT GGTCTAACCC TACAGGTAAT CGCGCGAGGG GTCGTGGTCG CTCTGGGATG GGGTTGTGGC GCTGAGATGG
TGGTGGGCGG CGCGAGGTTG TGTTCGCCGT GAGGTATGGT TCCCAACCGC TGAAATTTGG GGGGGCGCGG AGGATGGTCC
GGCGAGGGGT GATCTCATTG CGAGCAGGAT GGCGGGGACG CATGGTTTTC GTAGGGTAGG CGTGGTCGAG ATGGAAGCGG
CGACGGCGGC TGAGGTGGCC GGTGCCGGCA GCGGCACGGA TGGCGATTTG CAGATTAAAG GCAGCAAGGA GAATGGTCAG
ACTGCGGAGC AGCCGGCGGC CAGCGAGGCG CTTGAGATGC CCTCCACTCC GCTCCCGCTC CCGAGGGACA TAGATTGGTC
GGAGCATTTC TCCTTCTTCA ATTCGGTGGG CGGGTTTGGG GGCAGCATGG ATGGCGCGAG GGGCTTGACT AGTGTTGGCC
TATCTAATTC TGAGTCGAGG CCGGATAGTG TAACCCAGAT CCAGAGCTGT TTGAACAATG CAGACGAGAG GGTTGAGGAG
CTCACATTGA AAAATTGCAT CAGCTCCGAT GCGCAACATG AGGTTTCAGC TGGTGGAAGC ACGAGCAGCG GGGAGAAGCC
TACAGTTATG AGGGGTCTGT GGGGTAATTT TACAAGGATG TCATGGAGAG CTAGCGACGT GGCTAACAGG GAAAAATTAG
CAGCGAATCG TGGTGACGTT GCAAACTTGA GGGTCGGTGA CATGCCCATC AGGGAAAATT TGGCGGTGAG CTTCGGCAAC
AATATGATCT CACGAAATGA TGCATCCAAC AAGGAAATGG GAATGAGCCA TGGGGATCAT GCGAATAACG AGTTCAATTT
GCCGTTTGGT AATCAGCAGC CTTTTCTGTC TCCACGGCCT AATCAGAATG AGCAGCGAGT TGAAAGGGAG AATGCTCTCA
TAGTGAGTAG CTTTTCAGCT AGAATTCTGG ATCAGATGAG GAGTAAGAAT GTAACACCTT CGTCTGGGGT TCAGAGCTTC
CCATTTAAGA GTGTGTTGAA GGGTAAAGGT GTTGTATATC AAGGTGCACG AGAGGAGATC CAAGTTCAAG GTAATGCAAG
GACCAGAGCC CCTATGGATA AGATTCGCAA GATCCCTAAC ATACCACAGG ATTCCATGGC TAGAATGGAT GGTACAATCT
TTGGCAGTGG TGGAAATGTT TTAGAACCAC AGTGCGAGGG AACCAGCCTA AGGGAACTAA TTAAGCCTGC ACGCCAAACA
ATGAGCAAGT TTGAGAAAAT GCACTTCTTT AAGCAGATTC TTGATCTCGT AGACAAATCT CATGCCCAGG GTTTTAGTTT
ACAGCATTTG CGCCCATCAT ACTTTACTAT CTCAGCCTCA AACCAAGTAA AATATATTGG TTCTTATGGT ACCCAAGATT
TATCAGCCCC AAGCAAACTG GATATTGCGA CGGATGATAT TTTCAATACA AAAAGATACC TTGATCCCAA AGTTGAGTCC
CAAGATTCTA ATGGCGATAA TGCTTCAATC ACAAAGTATC AAAAAGTTGG TGAACAAGGA TCCATTGCTG TAAGGCGACC
AGTGCATACC TTTTGGGCTA ATCACAGAGG GGGCAACCAA AGTGAAGGTG TTGATCCTGG TGCTTTGTGG CAGGGCAATT
CGAGCTGCAC TGTCCGAGAA CGTTTTAAGG CTGCAGAACC TTTCTATGGT GGCAGTATGC CCTATGCTCA ACGACCATCA
AGTTCTGGCA ACCAACAGTC AGTATTTGAA TTGAGGATGC TGGAGGAAAG CTGGTACAGA AGTCCAGAAG AGATCAGTCA
GTTGAAAGGC ATACTTCCAT CAAACATCTA CAGCCTTGGG GTTCTTTTGT TTGAGGTATG CCAATTGCTT TCATCACATA
TCCTGAAGTA GTCCTCCAAA CACTTTGTAG TGTTAGAAAA GTAAAGTGAC ATTGTGCAAA TGCTATTTAT TTTCTTACCC
CATGAGGTTG TTTGTGGATG ATTTTTACTC TTAAGCCATT TGATGAGGAG TTCATGCTGT TTTTATGGTT CCACTTATGA
GTAGCTGAAA AATTGGGACA TGTATAGTGC AGAGTTTCCT ACTTATCCTA CTCAATAATA AGTATATGAG TATGCTGTCT
CCCTTATTTG TTTAGCAGCA GTTGGATTGC TGAAATGATC GGTTACTATT ATCATAATTG TATTTCTACG AATTTGAGAT
ATACCTGATT GAGATGTGCA ATTCTGACTG ACACAATGCA ACAGTCTTCT TGTTTGATGA AATAATATTG TTTGCTTATC
TAAGCTGCAT GGGCATATTA TTATTCTTTT TTTTAACATA TTCAGTAAAA TCTAATCTAG CCTTAACTAG TACAGAAGGT
CTACAGGATA TTCCATTAAT AGACTTCGCA TGTGCACGCA CAGACAATAG ATTATGATGG CTACTGGAAA TCACATTGAA
TTTTATCATT TCTAGTTTCC GTGGAATTCT TTGGTGCTAT CTTAAGCCTG GCTTGTAGTT GACAACATTC TCTTTCCTAC
CAGCTCTTTT GCTGCTGTGA AACATGGGAG GTACATTGTG CTGCAATGTC AGATCTCCGT CATCGCATTT TGCCCCCAAA
TTTTCTTTCA GAAAGTCCTA AAGAAGCTGG TTTCTGTCTT TGGTTACTCC ATCCAGATCC CTGTTCTCGG CCTAAGGCAA
GGTGAGCATG CTTGTCTCTC TCAGCGGTCA TCAGAAAGCA AGATACTTGG TGATTAATTG GATAGGATCA AATATTCATA
GGGTTACATT TTGGCAATTT CGTAAGTTAC ACTTCATACT CTAGGCAGTT CATTTGGCTG GTGGAGTGAA AGGATGAGAT
CTCAAGGCAT AATTAATTAA TTATTAGTTT GTTGTACCTG GTTACTTAAT GCTCCTGGCT CCTGTATTAA CTTAGCTTGC
TTCTATTTTT TTTAATATAG ATACACTGCT AGGGCTGGTA TTTTGTTGAA TGTTGAATGT TGAGCTTTAT TCATAGAATA
ATAGAGGACA TTGAGCATGA ACAAAATACG AAGTTCATGG AAAAGTGCTG ATCCCGGTCT AAATAATAGA AATCCTTTAT
TTGTTCATTG CACAAGGCAA TTATACATAA TCATTTCATT AGCATTACTT TTTTTTCCCT ACGTGGATGA TTTTTATTTT
CCATCTGCAG ACTTTGAATA ATACTTCCAA ACCAATTTAT GCCTGATGGA CATTTTGCTT TTTTGTCAGA GATATTCTAG
GGTGTGACTT GATAAATGAG GGTCGAGATT TGTCCTTGTT AGATAATAAA ACACCAGTTG CTGTCAATGA AGAAGACACC
GAATCTGGTT TGCTACTGGG CTTCCTTTCT CAACTCAAGG AAGAAAAGGA GATGCACGCT GCCAAATTGT CAGCTGATCT
TGCGAGCTTG GAAACAGATA TCGCAGAGGT TGAGAAAAGA CACTCAATGA GGATGGGATT TAGTTTAGAG GACATGGATG
TACTGGCAGG TTCTAATGAT CTCTCAGGAG CTTCTGCATG TGCCCTGGGA GGTGCATCAC TCTCAGGTTT GCCACCATCT
TTGTGCAGAT CGAGCATATA TGAGGAGCGG GTCATGAGAA ACTTGGAGCA GCTTGAAAAT GCATATTACT CCATGAGGTC
CACCATTGAC ACATCGGAGG CCAATATAAT TAAACGAGTT GATAATGATG CTTTAAGGGT TCGTCAAAAT TTTCACGAGC
TGCATAGTGA TGCTAATGCT ATCGATGAGC AAGCAGACCC CCTTGGATGG TTTTTCGATG GCTTATGCAA GTATGCCCGG
TATAGTAGGT TTGAAGTACG GGGAATTCTG AAGAATGCAG ATATACTTAA CTCACCAAAT GTGATTTGTT CGTTAAGTTT
TGATCGGGAT GAAGAATATT TTGCTGCTGC TGGTGTTTCA AAGAAAATTA AAATATTTGA ATTTGATGCC CTTTTAAATG
ATCGTGTTGA TATTCATTAC CCATTGATAG AGATGCCTAG CAAATCCAAG CTTAGCTGTG TCTGTTGGAA CAGCTACATA
AAAAATTACT TGGCATCAAC AGACTACGAT GGCACTGTTC AGGTATCTAT CTTATGGCCG AATATAAGAG GTCTATCTGC
TATTGTCAAG TTGCTATATT TTCATTCTTG CAGTTTCTGC TAGCTTCCAT TCAACAAAAC TGTTCATCTG ATTCAGTTAG
GTTTATAAAT ATATTCAGAT AATTTGGTTA TTTTGCTATC TAGGATACTG TTGATCTGCA AAATTGGTTT ATATAGTGAA
CATCACCTCA ATATTTAGCA AATGTTCTAC TGCAGTGCAG TGCCATGTCC TCATAATTTT AGCTTTGGGG CTGATAATAT
AATAGTAGTA TGTTCTTTTT TTTTTGGGTG CCCATTTTTT TTGTTACCAT TATGATAATG ATCCAAAAGA TACCACAAGT
GCACATGTAG GTTAGTATTT GGAGAAAGTG CTCTGAAGGT GAAATTTCCG AGCTTCTGAT TAAGGTTATC TGTAGGAAAC
TGAAAACGAT GAATATGGTT GAGAAAACAT TTCCTTGTCT TTGAGTTCTA CTGAAAGCCT ATGAAAAGTG AAAAATTATT
CAAATCATTC TACTGGGTTC CCTTTAGAAA GGACAAGGAA GGGGGTGATG GGGATTATCT ACCATATAAT TTGTTGAAGG
AACATATTAT AGGGAAAATA AAAATATGTT TAAAGAAGGG TGTTGAAGGA AGCAGAAACA TTATGGTTGC CATTATATCT
GTAACAATTT TCGTATATAG GTTGCTTCAC CTTGTAGTTT CCTTATTTGA AAAATGTCTG TACTGATTTT CTATCATCAT
AAGACACTTA TCATTTGCTA CTCTGAAAAA AACATGTCGT GCTCTGAACT GTTGTTCTTT TATGTGCTTA AAAGCAAACA
TCAATCTATA ATATAAGCAT CAGATGCATG GAAAAGCATT GCATATATTT CTTTTCTTTT TGCCATCGGT TTGATTATCA
CTGTGAAATG CAGTTGTGGG ATGCAAGCTC GGGTCAAGGA TTCACGCAGT TTACGGAGCA CCGAAAAAGA GCTTGGTCTG
TAAGTTTCTC AGAGGTGGAT CCAACTAAAT TGGCAAGTGG AAGTGATGAT TGCTGCGTGA AAGTTTGGAG TATTAACCAG
GCATGTTGTT GAACTAGTAC ATATTTGTTC TGCTATTTTT CTTAATCTGC TAAATGCTGT GAAGTAGGAT TTTGCAAAAT
CTGGTTGACT GGCTTGACAA GGTTGCCATG CATGCATGCA CCACAAATAA TAATGTTAAT TAGCTGTCAA ACCTTCTGGA
CTGCTTAACT TAGTTTTTGT ACAACCATAG GGTTAAGCAT GACAGACAGT GAAGTAATAC ATGATCTTTT TTTTCCTAAA
AAAGAAAAGG TGACACAGGG AGTTTCAGAT AAGATAAAAT GTTAATACTA TAAATTATTT TGTCTCGAGT CGACATTGCA
CCACTGTTGG TAAATCTGTA ACTCTGAAGC TATCCTGTTG GGCTAGGTTG GGATAGCTGA ACACTAAGAA ACATGCCAAG
TTAGGTAGGA ACCTTTCTTC AGTCAGAAGA ATGAGTCAAG CATAGGAAGA TACCTGAAAA GTACTCAAAA GTTTTTTTTG
TCCATTGATG CAGCAGTTAT CAATTTATCG TACATTAACA TAGTTTGATC TTATTTGTTG ATTATTTCCA CCTTCCTAGC
TAGATTTTTG TTTCCTGCCA CCTTTTCTTA TTCTGAGTCG ATGTCTTATT GTCACCAGAA AAATTGCACT GATACCATCA
GAAACGTGGC CAACGTGTGC TGTGTACAGT TCTCCCCATA CTCCTCTCGT ATGTTAGCTT TTGGCTCGGC TGATTATAAG
ATATACTGTT ATGATCTGAG GAATACAAGA ATCCCATGGT GTACTATTTC TGGGCATGGA AAAGCTGTCA GCTATGTACG
ATTCTTGGAT CCAGAAACAC TTATCTCTGC ATCAACTGAT AACACCTTGA AAATATGGGA TCTCAACCAG ACTAATTCCA
GTGGATTATC TACTGATGCC TGCAGTATGA CGTTGAGTGG CCATACCAAT GAGAAGGTAT GAGCAGATTT TGTATCATCT
CATTTTCAGA ATCAATTTAT ACTTGACCTC ACTGATAAGT GATAATTGTC CATGCAGAAT TTTGTGGGGT TATCTGTTCA
CGATGGATAC ATAACTTGTG GTTCTGAAAA TAATGAAGTG AGTATTATAT ACAATGCGGT TACTTTAATT GTTATACTGT
CAATTGGGTG TTCTGTTGAG TTGAAAACTT ACCTGAGTTC TTGTTAAGAA AATTATATGC CCAGGCCTCC CCCACCCTCA
ACTAGTTCGA TTGACATTTG GTGTTCTTTT TTTTTTCACC ATTTCTTCCT TTGTAACGAT TACCCAAGTC GTGCCATAAA
TTTGGCCCCA ATCATAACAC CTTGGTTCTA TGTTACGTAG TAGGATGGTG AAGTTTAGAT TATGCTCATT TGAAGGTTTA
TACATTAAAC ATCTCATGTC TTTATGTGAA GTCTTATTTG TGAACACTTT CATGATCTGA AATCAATGTC TCATCTTATA
TTTCTTCTGT TAACCTTTTT GTAGAAAAAG TTCTCATGTA TTTGGTGTTG ACATGCAGGT ATTTTCTTAT TACAAAACCT
TTCCCATGCC AATAACTTCT CACAAGTTCG GTTCAATCGA CCCAATAACT GGACAAGAGA CAAATGATGA TAACCAACAA
TTTGTGTCCA GTGTTTGCTG GCGAGGGAGG TCGAACATGG TAGTGGCTGC CAATTCTACT GGCAGCATTA AAGTGCTTGA
GCTTGTGTGA ATAAGTTGAT GGGAACTTTA GTGAATGGGA AGATCTGAAT CCTAAGGTTG CCATACTGCA TGGTTGATGC
TTAGCTGCCC TTGTATATTT CCGTGAACGT CTGCCTTCGC AGCAGGCAGC TACTCAAGCA TCAACCATCC TTCGGTTCTG
GGCTTCATTC CATCAGAGCA TTTGCAACAC TCAGTTTACC CCATTCAAGC AACCTACAGC GCCAAACTAT TGGTGGTGAA
GAGATCGGCG AACAAAGAGA ACAAAGAGAT CTTCGAAGGT ATGAAAGGTA CTGGCAATTC TTGAAGATGA TTGCCACCAC
CAAAATATTT TGTTTGTATG GCGTTTTGAC ATAGTACAAG TCAGCATTTT AAGGAGGGCC TTAGGGGTCT GTACAGATTA
GGGTCACAAA GGGTCGATGT AATATAATAT ATCATGAAAT TGGATATGCT TTTGGGCTAA AAAGCCTTAC ATGATACATC
TACTCGAGAA ATATCACTGG GAATTAAC