Os05t0571000-02

Locus

Os05g0571000

Description

Similar to SPA1 (SUPPRESSOR OF PHYA-105 1); protein binding / signal transducer.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-123, OsSPA1

Oryzabase Gene Name Synonym(s)

SPA1-like

Transcript Evidence

AK120171 (DDBJ, Best hit)

Protein Evidence

NP_182157.2 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

WD40 repeat (IPR001680)

Protein kinase-like domain (IPR011009)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

Serine/threonine-protein kinase-like domain (IPR017442)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

G-protein beta WD-40 repeat (IPR020472)

Full-length cDNA

J013032J17 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0571000-02)

Others

Oryzabase (10804)

Transcript

2680 bp

>Os05t0571000-02 Similar to SPA1 (SUPPRESSOR OF PHYA-105 1); protein binding / signal transducer.
ATCAGCCCCAAGCAAACTGGATATTGCGACGGATGATATTTTCAATACAAAAAGATACCT
TGATCCCAAAGTTGAGTCCCAAGATTCTAATGGCGATAATGCTTCAATCACAAAGTATCA
AAAAGTTGGTGAACAAGGATCCATTGCTGTAAGGCGACCAGTGCATACCTTTTGGGCTAA
TCACAGAGGGGGCAACCAAAGTGAAGGTGTTGATCCTGGTGCTTTGTGGCAGGGCAATTC
GAGCTGCACTGTCCGAGAACGTTTTAAGGCTGCAGAACCTTTCTATGGTGGCAGTATGCC
CTATGCTCAACGACCATCAAGTTCTGGCAACCAACAGTCAGTATTTGAATTGAGGATGCT
GGAGGAAAGCTGGTACAGAAGTCCAGAAGAGATCAGTCAGTTGAAAGGCATACTTCCATC
AAACATCTACAGCCTTGGGGTTCTTTTGTTTGAGCTCTTTTGCTGCTGTGAAACATGGGA
GGTACATTGTGCTGCAATGTCAGATCTCCGTCATCGCATTTTGCCCCCAAATTTTCTTTC
AGAAAGTCCTAAAGAAGCTGGTTTCTGTCTTTGGTTACTCCATCCAGATCCCTGTTCTCG
GCCTAAGGCAAGAGATATTCTAGGGTGTGACTTGATAAATGAGGGTCGAGATTTGTCCTT
GTTAGATAATAAAACACCAGTTGCTGTCAATGAAGAAGACACCGAATCTGGTTTGCTACT
GGGCTTCCTTTCTCAACTCAAGGAAGAAAAGGAGATGCACGCTGCCAAATTGTCAGCTGA
TCTTGCGAGCTTGGAAACAGATATCGCAGAGGTTGAGAAAAGACACTCAATGAGGATGGG
ATTTAGTTTAGAGGACATGGATGTACTGGCAGGTTCTAATGATCTCTCAGGAGCTTCTGC
ATGTGCCCTGGGAGGTGCATCACTCTCAGGTTTGCCACCATCTTTGTGCAGATCGAGCAT
ATATGAGGAGCGGGTCATGAGAAACTTGGAGCAGCTTGAAAATGCATATTACTCCATGAG
GTCCACCATTGACACATCGGAGGCCAATATAATTAAACGAGTTGATAATGATGCTTTAAG
GGTTCGTCAAAATTTTCACGAGCTGCATAGTGATGCTAATGCTATCGATGAGCAAGCAGA
CCCCCTTGGATGGTTTTTCGATGGCTTATGCAAGTATGCCCGGTATAGTAGGTTTGAAGT
ACGGGGAATTCTGAAGAATGCAGATATACTTAACTCACCAAATGTGATTTGTTCGTTAAG
TTTTGATCGGGATGAAGAATATTTTGCTGCTGCTGGTGTTTCAAAGAAAATTAAAATATT
TGAATTTGATGCCCTTTTAAATGATCGTGTTGATATTCATTACCCATTGATAGAGATGCC
TAGCAAATCCAAGCTTAGCTGTGTCTGTTGGAACAGCTACATAAAAAATTACTTGGCATC
AACAGACTACGATGGCACTGTTCAGTTGTGGGATGCAAGCTCGGGTCAAGGATTCACGCA
GTTTACGGAGCACCGAAAAAGAGCTTGGTCTGTAAGTTTCTCAGAGGTGGATCCAACTAA
ATTGGCAAGTGGAAGTGATGATTGCTGCGTGAAAGTTTGGAGTATTAACCAGAAAAATTG
CACTGATACCATCAGAAACGTGGCCAACGTGTGCTGTGTACAGTTCTCCCCATACTCCTC
TCGTATGTTAGCTTTTGGCTCGGCTGATTATAAGATATACTGTTATGATCTGAGGAATAC
AAGAATCCCATGGTGTACTATTTCTGGGCATGGAAAAGCTGTCAGCTATGTACGATTCTT
GGATCCAGAAACACTTATCTCTGCATCAACTGATAACACCTTGAAAATATGGGATCTCAA
CCAGACTAATTCCAGTGGATTATCTACTGATGCCTGCAGTATGACGTTGAGTGGCCATAC
CAATGAGAAGAATTTTGTGGGGTTATCTGTTCACGATGGATACATAACTTGTGGTTCTGA
AAATAATGAAGTATTTTCTTATTACAAAACCTTTCCCATGCCAATAACTTCTCACAAGTT
CGGTTCAATCGACCCAATAACTGGACAAGAGACAAATGATGATAACCAACAATTTGTGTC
CAGTGTTTGCTGGCGAGGGAGGTCGAACATGGTAGTGGCTGCCAATTCTACTGGCAGCAT
TAAAGTGCTTGAGCTTGTGTGAATAAGTTGATGGGAACTTTAGTGAATGGGAAGATCTGA
ATCCTAAGGTTGCCATACTGCATGGTTGATGCTTAGCTGCCCTTGTATATTTCCGTGAAC
GTCTGCCTTCGCAGCAGGCAGCTACTCAAGCATCAACCATCCTTCGGTTCTGGGCTTCAT
TCCATCAGAGCATTTGCAACACTCAGTTTACCCCATTCAAGCAACCTACAGCGCCAAACT
ATTGGTGGTGAAGAGATCGGCGAACAAAGAGAACAAAGAGATCTTCGAAGGTATGAAAGG
TACTGGCAATTCTTGAAGATGATTGCCACCACCAAAATATTTTGTTTGTATGGCGTTTTG
ACATAGTACAAGTCAGCATTTTAAGGAGGGCCTTAGGGGTCTGTACAGATTAGGGTCACA
AAGGGTCGATGTAATATAATATATCATGAAATTGGATATGCTTTTGGGCTAAAAAGCCTT
ACATGATACATCTACTCGAGAAATATCACTGGGAATTAAC

CDS

2181 bp

>Os05t0571000-02 Similar to SPA1 (SUPPRESSOR OF PHYA-105 1); protein binding / signal transducer.
TCAGCCCCAAGCAAACTGGATATTGCGACGGATGATATTTTCAATACAAAAAGATACCTT
GATCCCAAAGTTGAGTCCCAAGATTCTAATGGCGATAATGCTTCAATCACAAAGTATCAA
AAAGTTGGTGAACAAGGATCCATTGCTGTAAGGCGACCAGTGCATACCTTTTGGGCTAAT
CACAGAGGGGGCAACCAAAGTGAAGGTGTTGATCCTGGTGCTTTGTGGCAGGGCAATTCG
AGCTGCACTGTCCGAGAACGTTTTAAGGCTGCAGAACCTTTCTATGGTGGCAGTATGCCC
TATGCTCAACGACCATCAAGTTCTGGCAACCAACAGTCAGTATTTGAATTGAGGATGCTG
GAGGAAAGCTGGTACAGAAGTCCAGAAGAGATCAGTCAGTTGAAAGGCATACTTCCATCA
AACATCTACAGCCTTGGGGTTCTTTTGTTTGAGCTCTTTTGCTGCTGTGAAACATGGGAG
GTACATTGTGCTGCAATGTCAGATCTCCGTCATCGCATTTTGCCCCCAAATTTTCTTTCA
GAAAGTCCTAAAGAAGCTGGTTTCTGTCTTTGGTTACTCCATCCAGATCCCTGTTCTCGG
CCTAAGGCAAGAGATATTCTAGGGTGTGACTTGATAAATGAGGGTCGAGATTTGTCCTTG
TTAGATAATAAAACACCAGTTGCTGTCAATGAAGAAGACACCGAATCTGGTTTGCTACTG
GGCTTCCTTTCTCAACTCAAGGAAGAAAAGGAGATGCACGCTGCCAAATTGTCAGCTGAT
CTTGCGAGCTTGGAAACAGATATCGCAGAGGTTGAGAAAAGACACTCAATGAGGATGGGA
TTTAGTTTAGAGGACATGGATGTACTGGCAGGTTCTAATGATCTCTCAGGAGCTTCTGCA
TGTGCCCTGGGAGGTGCATCACTCTCAGGTTTGCCACCATCTTTGTGCAGATCGAGCATA
TATGAGGAGCGGGTCATGAGAAACTTGGAGCAGCTTGAAAATGCATATTACTCCATGAGG
TCCACCATTGACACATCGGAGGCCAATATAATTAAACGAGTTGATAATGATGCTTTAAGG
GTTCGTCAAAATTTTCACGAGCTGCATAGTGATGCTAATGCTATCGATGAGCAAGCAGAC
CCCCTTGGATGGTTTTTCGATGGCTTATGCAAGTATGCCCGGTATAGTAGGTTTGAAGTA
CGGGGAATTCTGAAGAATGCAGATATACTTAACTCACCAAATGTGATTTGTTCGTTAAGT
TTTGATCGGGATGAAGAATATTTTGCTGCTGCTGGTGTTTCAAAGAAAATTAAAATATTT
GAATTTGATGCCCTTTTAAATGATCGTGTTGATATTCATTACCCATTGATAGAGATGCCT
AGCAAATCCAAGCTTAGCTGTGTCTGTTGGAACAGCTACATAAAAAATTACTTGGCATCA
ACAGACTACGATGGCACTGTTCAGTTGTGGGATGCAAGCTCGGGTCAAGGATTCACGCAG
TTTACGGAGCACCGAAAAAGAGCTTGGTCTGTAAGTTTCTCAGAGGTGGATCCAACTAAA
TTGGCAAGTGGAAGTGATGATTGCTGCGTGAAAGTTTGGAGTATTAACCAGAAAAATTGC
ACTGATACCATCAGAAACGTGGCCAACGTGTGCTGTGTACAGTTCTCCCCATACTCCTCT
CGTATGTTAGCTTTTGGCTCGGCTGATTATAAGATATACTGTTATGATCTGAGGAATACA
AGAATCCCATGGTGTACTATTTCTGGGCATGGAAAAGCTGTCAGCTATGTACGATTCTTG
GATCCAGAAACACTTATCTCTGCATCAACTGATAACACCTTGAAAATATGGGATCTCAAC
CAGACTAATTCCAGTGGATTATCTACTGATGCCTGCAGTATGACGTTGAGTGGCCATACC
AATGAGAAGAATTTTGTGGGGTTATCTGTTCACGATGGATACATAACTTGTGGTTCTGAA
AATAATGAAGTATTTTCTTATTACAAAACCTTTCCCATGCCAATAACTTCTCACAAGTTC
GGTTCAATCGACCCAATAACTGGACAAGAGACAAATGATGATAACCAACAATTTGTGTCC
AGTGTTTGCTGGCGAGGGAGGTCGAACATGGTAGTGGCTGCCAATTCTACTGGCAGCATT
AAAGTGCTTGAGCTTGTGTGA

Protein

727 aa

>Os05t0571000-02 Similar to SPA1 (SUPPRESSOR OF PHYA-105 1); protein binding / signal transducer.
SAPSKLDIATDDIFNTKRYLDPKVESQDSNGDNASITKYQKVGEQGSIAVRRPVHTFWAN
HRGGNQSEGVDPGALWQGNSSCTVRERFKAAEPFYGGSMPYAQRPSSSGNQQSVFELRML
EESWYRSPEEISQLKGILPSNIYSLGVLLFELFCCCETWEVHCAAMSDLRHRILPPNFLS
ESPKEAGFCLWLLHPDPCSRPKARDILGCDLINEGRDLSLLDNKTPVAVNEEDTESGLLL
GFLSQLKEEKEMHAAKLSADLASLETDIAEVEKRHSMRMGFSLEDMDVLAGSNDLSGASA
CALGGASLSGLPPSLCRSSIYEERVMRNLEQLENAYYSMRSTIDTSEANIIKRVDNDALR
VRQNFHELHSDANAIDEQADPLGWFFDGLCKYARYSRFEVRGILKNADILNSPNVICSLS
FDRDEEYFAAAGVSKKIKIFEFDALLNDRVDIHYPLIEMPSKSKLSCVCWNSYIKNYLAS
TDYDGTVQLWDASSGQGFTQFTEHRKRAWSVSFSEVDPTKLASGSDDCCVKVWSINQKNC
TDTIRNVANVCCVQFSPYSSRMLAFGSADYKIYCYDLRNTRIPWCTISGHGKAVSYVRFL
DPETLISASTDNTLKIWDLNQTNSSGLSTDACSMTLSGHTNEKNFVGLSVHDGYITCGSE
NNEVFSYYKTFPMPITSHKFGSIDPITGQETNDDNQQFVSSVCWRGRSNMVVAANSTGSI
KVLELV*

5'UTR

chr05:28451170..28451170 (- strand) : 1 bp

CDS

chr05:28450717..28451169 (- strand) : 453 bp

chr05:28449891..28450048 (- strand) : 158 bp

chr05:28448490..28449342 (- strand) : 853 bp

chr05:28447412..28447558 (- strand) : 147 bp

chr05:28446476..28446793 (- strand) : 318 bp

chr05:28446335..28446394 (- strand) : 60 bp

chr05:28445722..28445913 (- strand) : 192 bp

3'UTR

chr05:28445224..28445721 (- strand) : 498 bp

FASTA

>Os05t0571000-02 class=Sequence position=chr05:28445224..28451170 (- strand)
ATCAGCCCCA AGCAAACTGG ATATTGCGAC GGATGATATT TTCAATACAA AAAGATACCT TGATCCCAAA GTTGAGTCCC
AAGATTCTAA TGGCGATAAT GCTTCAATCA CAAAGTATCA AAAAGTTGGT GAACAAGGAT CCATTGCTGT AAGGCGACCA
GTGCATACCT TTTGGGCTAA TCACAGAGGG GGCAACCAAA GTGAAGGTGT TGATCCTGGT GCTTTGTGGC AGGGCAATTC
GAGCTGCACT GTCCGAGAAC GTTTTAAGGC TGCAGAACCT TTCTATGGTG GCAGTATGCC CTATGCTCAA CGACCATCAA
GTTCTGGCAA CCAACAGTCA GTATTTGAAT TGAGGATGCT GGAGGAAAGC TGGTACAGAA GTCCAGAAGA GATCAGTCAG
TTGAAAGGCA TACTTCCATC AAACATCTAC AGCCTTGGGG TTCTTTTGTT TGAGGTATGC CAATTGCTTT CATCACATAT
CCTGAAGTAG TCCTCCAAAC ACTTTGTAGT GTTAGAAAAG TAAAGTGACA TTGTGCAAAT GCTATTTATT TTCTTACCCC
ATGAGGTTGT TTGTGGATGA TTTTTACTCT TAAGCCATTT GATGAGGAGT TCATGCTGTT TTTATGGTTC CACTTATGAG
TAGCTGAAAA ATTGGGACAT GTATAGTGCA GAGTTTCCTA CTTATCCTAC TCAATAATAA GTATATGAGT ATGCTGTCTC
CCTTATTTGT TTAGCAGCAG TTGGATTGCT GAAATGATCG GTTACTATTA TCATAATTGT ATTTCTACGA ATTTGAGATA
TACCTGATTG AGATGTGCAA TTCTGACTGA CACAATGCAA CAGTCTTCTT GTTTGATGAA ATAATATTGT TTGCTTATCT
AAGCTGCATG GGCATATTAT TATTCTTTTT TTTAACATAT TCAGTAAAAT CTAATCTAGC CTTAACTAGT ACAGAAGGTC
TACAGGATAT TCCATTAATA GACTTCGCAT GTGCACGCAC AGACAATAGA TTATGATGGC TACTGGAAAT CACATTGAAT
TTTATCATTT CTAGTTTCCG TGGAATTCTT TGGTGCTATC TTAAGCCTGG CTTGTAGTTG ACAACATTCT CTTTCCTACC
AGCTCTTTTG CTGCTGTGAA ACATGGGAGG TACATTGTGC TGCAATGTCA GATCTCCGTC ATCGCATTTT GCCCCCAAAT
TTTCTTTCAG AAAGTCCTAA AGAAGCTGGT TTCTGTCTTT GGTTACTCCA TCCAGATCCC TGTTCTCGGC CTAAGGCAAG
GTGAGCATGC TTGTCTCTCT CAGCGGTCAT CAGAAAGCAA GATACTTGGT GATTAATTGG ATAGGATCAA ATATTCATAG
GGTTACATTT TGGCAATTTC GTAAGTTACA CTTCATACTC TAGGCAGTTC ATTTGGCTGG TGGAGTGAAA GGATGAGATC
TCAAGGCATA ATTAATTAAT TATTAGTTTG TTGTACCTGG TTACTTAATG CTCCTGGCTC CTGTATTAAC TTAGCTTGCT
TCTATTTTTT TTAATATAGA TACACTGCTA GGGCTGGTAT TTTGTTGAAT GTTGAATGTT GAGCTTTATT CATAGAATAA
TAGAGGACAT TGAGCATGAA CAAAATACGA AGTTCATGGA AAAGTGCTGA TCCCGGTCTA AATAATAGAA ATCCTTTATT
TGTTCATTGC ACAAGGCAAT TATACATAAT CATTTCATTA GCATTACTTT TTTTTCCCTA CGTGGATGAT TTTTATTTTC
CATCTGCAGA CTTTGAATAA TACTTCCAAA CCAATTTATG CCTGATGGAC ATTTTGCTTT TTTGTCAGAG ATATTCTAGG
GTGTGACTTG ATAAATGAGG GTCGAGATTT GTCCTTGTTA GATAATAAAA CACCAGTTGC TGTCAATGAA GAAGACACCG
AATCTGGTTT GCTACTGGGC TTCCTTTCTC AACTCAAGGA AGAAAAGGAG ATGCACGCTG CCAAATTGTC AGCTGATCTT
GCGAGCTTGG AAACAGATAT CGCAGAGGTT GAGAAAAGAC ACTCAATGAG GATGGGATTT AGTTTAGAGG ACATGGATGT
ACTGGCAGGT TCTAATGATC TCTCAGGAGC TTCTGCATGT GCCCTGGGAG GTGCATCACT CTCAGGTTTG CCACCATCTT
TGTGCAGATC GAGCATATAT GAGGAGCGGG TCATGAGAAA CTTGGAGCAG CTTGAAAATG CATATTACTC CATGAGGTCC
ACCATTGACA CATCGGAGGC CAATATAATT AAACGAGTTG ATAATGATGC TTTAAGGGTT CGTCAAAATT TTCACGAGCT
GCATAGTGAT GCTAATGCTA TCGATGAGCA AGCAGACCCC CTTGGATGGT TTTTCGATGG CTTATGCAAG TATGCCCGGT
ATAGTAGGTT TGAAGTACGG GGAATTCTGA AGAATGCAGA TATACTTAAC TCACCAAATG TGATTTGTTC GTTAAGTTTT
GATCGGGATG AAGAATATTT TGCTGCTGCT GGTGTTTCAA AGAAAATTAA AATATTTGAA TTTGATGCCC TTTTAAATGA
TCGTGTTGAT ATTCATTACC CATTGATAGA GATGCCTAGC AAATCCAAGC TTAGCTGTGT CTGTTGGAAC AGCTACATAA
AAAATTACTT GGCATCAACA GACTACGATG GCACTGTTCA GGTATCTATC TTATGGCCGA ATATAAGAGG TCTATCTGCT
ATTGTCAAGT TGCTATATTT TCATTCTTGC AGTTTCTGCT AGCTTCCATT CAACAAAACT GTTCATCTGA TTCAGTTAGG
TTTATAAATA TATTCAGATA ATTTGGTTAT TTTGCTATCT AGGATACTGT TGATCTGCAA AATTGGTTTA TATAGTGAAC
ATCACCTCAA TATTTAGCAA ATGTTCTACT GCAGTGCAGT GCCATGTCCT CATAATTTTA GCTTTGGGGC TGATAATATA
ATAGTAGTAT GTTCTTTTTT TTTTGGGTGC CCATTTTTTT TGTTACCATT ATGATAATGA TCCAAAAGAT ACCACAAGTG
CACATGTAGG TTAGTATTTG GAGAAAGTGC TCTGAAGGTG AAATTTCCGA GCTTCTGATT AAGGTTATCT GTAGGAAACT
GAAAACGATG AATATGGTTG AGAAAACATT TCCTTGTCTT TGAGTTCTAC TGAAAGCCTA TGAAAAGTGA AAAATTATTC
AAATCATTCT ACTGGGTTCC CTTTAGAAAG GACAAGGAAG GGGGTGATGG GGATTATCTA CCATATAATT TGTTGAAGGA
ACATATTATA GGGAAAATAA AAATATGTTT AAAGAAGGGT GTTGAAGGAA GCAGAAACAT TATGGTTGCC ATTATATCTG
TAACAATTTT CGTATATAGG TTGCTTCACC TTGTAGTTTC CTTATTTGAA AAATGTCTGT ACTGATTTTC TATCATCATA
AGACACTTAT CATTTGCTAC TCTGAAAAAA ACATGTCGTG CTCTGAACTG TTGTTCTTTT ATGTGCTTAA AAGCAAACAT
CAATCTATAA TATAAGCATC AGATGCATGG AAAAGCATTG CATATATTTC TTTTCTTTTT GCCATCGGTT TGATTATCAC
TGTGAAATGC AGTTGTGGGA TGCAAGCTCG GGTCAAGGAT TCACGCAGTT TACGGAGCAC CGAAAAAGAG CTTGGTCTGT
AAGTTTCTCA GAGGTGGATC CAACTAAATT GGCAAGTGGA AGTGATGATT GCTGCGTGAA AGTTTGGAGT ATTAACCAGG
CATGTTGTTG AACTAGTACA TATTTGTTCT GCTATTTTTC TTAATCTGCT AAATGCTGTG AAGTAGGATT TTGCAAAATC
TGGTTGACTG GCTTGACAAG GTTGCCATGC ATGCATGCAC CACAAATAAT AATGTTAATT AGCTGTCAAA CCTTCTGGAC
TGCTTAACTT AGTTTTTGTA CAACCATAGG GTTAAGCATG ACAGACAGTG AAGTAATACA TGATCTTTTT TTTCCTAAAA
AAGAAAAGGT GACACAGGGA GTTTCAGATA AGATAAAATG TTAATACTAT AAATTATTTT GTCTCGAGTC GACATTGCAC
CACTGTTGGT AAATCTGTAA CTCTGAAGCT ATCCTGTTGG GCTAGGTTGG GATAGCTGAA CACTAAGAAA CATGCCAAGT
TAGGTAGGAA CCTTTCTTCA GTCAGAAGAA TGAGTCAAGC ATAGGAAGAT ACCTGAAAAG TACTCAAAAG TTTTTTTTGT
CCATTGATGC AGCAGTTATC AATTTATCGT ACATTAACAT AGTTTGATCT TATTTGTTGA TTATTTCCAC CTTCCTAGCT
AGATTTTTGT TTCCTGCCAC CTTTTCTTAT TCTGAGTCGA TGTCTTATTG TCACCAGAAA AATTGCACTG ATACCATCAG
AAACGTGGCC AACGTGTGCT GTGTACAGTT CTCCCCATAC TCCTCTCGTA TGTTAGCTTT TGGCTCGGCT GATTATAAGA
TATACTGTTA TGATCTGAGG AATACAAGAA TCCCATGGTG TACTATTTCT GGGCATGGAA AAGCTGTCAG CTATGTACGA
TTCTTGGATC CAGAAACACT TATCTCTGCA TCAACTGATA ACACCTTGAA AATATGGGAT CTCAACCAGA CTAATTCCAG
TGGATTATCT ACTGATGCCT GCAGTATGAC GTTGAGTGGC CATACCAATG AGAAGGTATG AGCAGATTTT GTATCATCTC
ATTTTCAGAA TCAATTTATA CTTGACCTCA CTGATAAGTG ATAATTGTCC ATGCAGAATT TTGTGGGGTT ATCTGTTCAC
GATGGATACA TAACTTGTGG TTCTGAAAAT AATGAAGTGA GTATTATATA CAATGCGGTT ACTTTAATTG TTATACTGTC
AATTGGGTGT TCTGTTGAGT TGAAAACTTA CCTGAGTTCT TGTTAAGAAA ATTATATGCC CAGGCCTCCC CCACCCTCAA
CTAGTTCGAT TGACATTTGG TGTTCTTTTT TTTTTCACCA TTTCTTCCTT TGTAACGATT ACCCAAGTCG TGCCATAAAT
TTGGCCCCAA TCATAACACC TTGGTTCTAT GTTACGTAGT AGGATGGTGA AGTTTAGATT ATGCTCATTT GAAGGTTTAT
ACATTAAACA TCTCATGTCT TTATGTGAAG TCTTATTTGT GAACACTTTC ATGATCTGAA ATCAATGTCT CATCTTATAT
TTCTTCTGTT AACCTTTTTG TAGAAAAAGT TCTCATGTAT TTGGTGTTGA CATGCAGGTA TTTTCTTATT ACAAAACCTT
TCCCATGCCA ATAACTTCTC ACAAGTTCGG TTCAATCGAC CCAATAACTG GACAAGAGAC AAATGATGAT AACCAACAAT
TTGTGTCCAG TGTTTGCTGG CGAGGGAGGT CGAACATGGT AGTGGCTGCC AATTCTACTG GCAGCATTAA AGTGCTTGAG
CTTGTGTGAA TAAGTTGATG GGAACTTTAG TGAATGGGAA GATCTGAATC CTAAGGTTGC CATACTGCAT GGTTGATGCT
TAGCTGCCCT TGTATATTTC CGTGAACGTC TGCCTTCGCA GCAGGCAGCT ACTCAAGCAT CAACCATCCT TCGGTTCTGG
GCTTCATTCC ATCAGAGCAT TTGCAACACT CAGTTTACCC CATTCAAGCA ACCTACAGCG CCAAACTATT GGTGGTGAAG
AGATCGGCGA ACAAAGAGAA CAAAGAGATC TTCGAAGGTA TGAAAGGTAC TGGCAATTCT TGAAGATGAT TGCCACCACC
AAAATATTTT GTTTGTATGG CGTTTTGACA TAGTACAAGT CAGCATTTTA AGGAGGGCCT TAGGGGTCTG TACAGATTAG
GGTCACAAAG GGTCGATGTA ATATAATATA TCATGAAATT GGATATGCTT TTGGGCTAAA AAGCCTTACA TGATACATCT
ACTCGAGAAA TATCACTGGG AATTAAC