Os05t0573500-01

Locus

Os05g0573500

Description

CCAAT-box binding transcription factor, Chloroplast biogenesis

RAP-DB Gene Symbol Synonym(s)

HAP3C, OsHAP3C, OsNF-YB-4, NFYB4

RAP-DB Gene Name Synonym(s)

HAP3C SUBUNIT OF CCAAT-BOX BINDING COMPLEX, rice HAP3C, Nuclear transcription factor Y subunit B-4, Transcriptional activator HAP3C

CGSNL Gene Symbol

HAP3B

CGSNL Gene Name

HAP3B SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3B, OsNF-YB-3, NFYB3, OsNF-YB4, NF-YB4, NFYB4, OsHAP3C, HAP3C

Oryzabase Gene Name Synonym(s)

rice HAP3B, Nuclear transcription factor Y subunit B-3, Transcriptional activator HAP3B, NUCLEAR FACTOR-Y subunit B4, NUCLEAR FACTOR-Y subunit NF-YB4, NF-YB subunit 4, NF-YB family 4

Transcript Evidence

AB095440

Protein Evidence

Q65XK1

Q0DFS6

Literature

PMID: 14617083

PMID: 18193457

Note

Manual Curation

January 7, 2010

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Molecular Function: protein heterodimerization activity (GO:0046982)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Histone-fold (IPR009072)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Expression Databases

TENOR (Os05t0573500-00)

Others

Oryzabase (3124)

Transcript

854 bp

>Os05t0573500-01 CCAAT-box binding transcription factor, Chloroplast biogenesis
AGCATCGTCTCCAGCGGAGTCAAACACAAAGACAAGTCGAGATCCGGCGGCCGGTGGCGT
CCTCCTCCCTCTCCCTCCTCCCCAACCAACGGCGCTGATCCCCTCCGCCATCTCCGTCCA
TCTCCGCCTAAAAAAACTAAGCGATGTCGGAGGGGTTCGACGGGACGGAGAACGGCGGCG
GCGGCGGCGGAGGCGGAGTAGGGAAGGAGCAGGACCGGTTCCTGCCGATCGCCAACATCG
GCCGCATCATGCGCCGGGCCGTGCCGGAGAACGGCAAGATCGCCAAGGACTCCAAGGAGT
CCGTCCAGGAGTGCGTCTCCGAGTTCATCAGCTTCATCACCAGCGAAGCAAGCGACAAGT
GCCTCAAGGAGAAGCGCAAGACCATCAATGGGGACGACCTGATCTGGTCAATGGGCACGC
TCGGATTCGAGGACTATGTCGAGCCTCTCAAGCTCTACCTCAGGCTCTACCGGGAGACGG
AGGGTGACACAAAGGGTTCAAGAGCTTCTGAACTGCCAGTAAAGAAAGATGTTGTACTTA
ATGGAGATCCTGGATCATCGTTTGAAGGCATGTAGGACGAGGAGTGTGATAGCATCTAGG
AAGGAGAACCATCGTTTTTAGGGAAAGAACGCTCCAGCATCCTGTTATGTTGTAAGCAGG
ATGCTTCTAAAGTTCCAATACCTTGTTACCACGAATGTTAGTCGTCGTTCTTTTTGAAAT
GTTCTTGTGTTAGCCAGGATGTCCAAATTTGTTGTAGGTTCTAGTTCAGTCGTGTGTTGT
GTGGTTGTGTCTAACCATATTTGGCCGTTTCCGGCTGTCCTGCATATGCTAAATTCAGAG
GGGTAAAGAGATCT

CDS

432 bp

>Os05t0573500-01 CCAAT-box binding transcription factor, Chloroplast biogenesis
ATGTCGGAGGGGTTCGACGGGACGGAGAACGGCGGCGGCGGCGGCGGAGGCGGAGTAGGG
AAGGAGCAGGACCGGTTCCTGCCGATCGCCAACATCGGCCGCATCATGCGCCGGGCCGTG
CCGGAGAACGGCAAGATCGCCAAGGACTCCAAGGAGTCCGTCCAGGAGTGCGTCTCCGAG
TTCATCAGCTTCATCACCAGCGAAGCAAGCGACAAGTGCCTCAAGGAGAAGCGCAAGACC
ATCAATGGGGACGACCTGATCTGGTCAATGGGCACGCTCGGATTCGAGGACTATGTCGAG
CCTCTCAAGCTCTACCTCAGGCTCTACCGGGAGACGGAGGGTGACACAAAGGGTTCAAGA
GCTTCTGAACTGCCAGTAAAGAAAGATGTTGTACTTAATGGAGATCCTGGATCATCGTTT
GAAGGCATGTAG

Protein

144 aa

>Os05t0573500-01 CCAAT-box binding transcription factor, Chloroplast biogenesis
MSEGFDGTENGGGGGGGGVGKEQDRFLPIANIGRIMRRAVPENGKIAKDSKESVQECVSE
FISFITSEASDKCLKEKRKTINGDDLIWSMGTLGFEDYVEPLKLYLRLYRETEGDTKGSR
ASELPVKKDVVLNGDPGSSFEGM*

5'UTR

chr05:28572426..28572566 (+ strand) : 141 bp

chr05:28572644..28572645 (+ strand) : 2 bp

CDS

chr05:28572646..28572848 (+ strand) : 203 bp

chr05:28573005..28573134 (+ strand) : 130 bp

chr05:28574014..28574019 (+ strand) : 6 bp

chr05:28574100..28574177 (+ strand) : 78 bp

chr05:28574861..28574875 (+ strand) : 15 bp

3'UTR

chr05:28574876..28575154 (+ strand) : 279 bp

FASTA

>Os05t0573500-01 class=Sequence position=chr05:28572426..28575154 (+ strand)
AGCATCGTCT CCAGCGGAGT CAAACACAAA GACAAGTCGA GATCCGGCGG CCGGTGGCGT CCTCCTCCCT CTCCCTCCTC
CCCAACCAAC GGCGCTGATC CCCTCCGCCA TCTCCGTCCA TCTCCGCCTA AAAAAACTAA GGTAAGCCAC CAACTTTCCC
TTGACACCAG CAGTAGTGGT AGTCGCTCTC CTTCTCACCG ACCTCTGCCA TGGCCCAGCG ATGTCGGAGG GGTTCGACGG
GACGGAGAAC GGCGGCGGCG GCGGCGGAGG CGGAGTAGGG AAGGAGCAGG ACCGGTTCCT GCCGATCGCC AACATCGGCC
GCATCATGCG CCGGGCCGTG CCGGAGAACG GCAAGATCGC CAAGGACTCC AAGGAGTCCG TCCAGGAGTG CGTCTCCGAG
TTCATCAGCT TCATCACCAG CGAGTCAGTG TCGCCTCGCC TTTGTATTTG CTGTATATAT CGGTGCCGGA GCTTGCTTGA
TCCGATCCAG TTCGGAGCGG CGGCGGCGCA TTTTGTCGTG CACCTGCCGT GCAGATGGCA AGGGTGACTG ACGGCCATCT
TTGGCATCTT TCCCTGCAGA GCAAGCGACA AGTGCCTCAA GGAGAAGCGC AAGACCATCA ATGGGGACGA CCTGATCTGG
TCAATGGGCA CGCTCGGATT CGAGGACTAT GTCGAGCCTC TCAAGCTCTA CCTCAGGCTC TACCGGGAGG TATTGTTCCT
CTCCTCTCTC TTCCAGAGTG TTTCCTAGTA TTGTATTGCC TAGTGATGCA TATGTTACTA CGTGGGAAGT GAAGGCTGGT
TCACCTCGAT TAGGTAGGCG TAGGCTTCTA TATTCGCACA CAGTTTGCCT AAGCTTTTGA TACACAGACT GATGCTCATA
CGAGCTCTGC ACTGATTGGA TTGTGCATAT ACCATGAGGC CATGATTCGT GCAAAAGGAG AGAGCTTTCG TGATTGTACT
TATATCAAGG CTTTGACTTA GTATTACTTG GTCTGTCACA TGGGTTGATT CACTCCAAAT TGATGGATGG TTGATTTAGT
TGCCAACAGT AGATTGCGGA AAGGTTGAAT GTGCTGCCTG AATGTTAAGC GCCCAATATT TCTAGGTCCA GGGCATGCAC
TGTAAAGGTG GAATTTTCTT TGTACTTATT GGCATGAACC GATTCAAAAT GGCCGTAGTC TTCCATCTGT AGGCGTGCTG
CTGGCAGAGT GGCCAGGTTA ACATGGACTG TAATTTTGTT TTATGTCCAT AAAGCTACAT ATCTGATGAA CGCCAATGCA
AACTTGCAAT TGTCAGATTA TGAACTACAT TTATGCTGAA GACATGTAAC ATTTTTGCTG AACTGACATT AGTGCCTGGA
CCAAGATTGA TTTTTTTTCA TCAGCATATA TTTTTAATTT CAATCACTAG TGAGATATAA AATACAACAA AAGGATGTTT
CATTGTCCTC CAGAAAAAGA TATTTACCGA TATAATTTCC TTTGTTTTCT TTTCCATATT ATACACAAAT TTTTACGTGC
ACTGATAGTT TTTTCCCCTT TCTTGCATGA ATAACAACGG CCGTTGATTA CCCTTGATGG TACTGAAGAC GGAGGTATTT
CCCATGTTGT ATTACTTGTT AATCTTTAAG TTTTGTTAAT GAAGGTTTAT TCAATTTACT TGTTGATCTT CTAGGGTGAC
ACAAAGGGTT CAAGAGCTTC TGAACTGCCA GTAAAGAAAG ATGTTGTACT TAATGGAGAT CCTGGATCAT CGGTAATATA
TAGTTCCTTG TGCCAAGTTT TAATAAAACG AAACATTGCA CTACCATCTG CCTTTCTTTA TTGTCAAGCA CACATTCACA
TATTTTTCCC TACAACTTGC TGTATTATCT TTTTTGCAAG TGCTACATCA ATATGCACAA AACTCTCATT GTTTTGACCA
TTCTTCTATT CATGCCAGTA TGCCACTAGC TGATGCATCA GCAGCGTGAA AATGTTAACT GTTTTTTTTA GTTTCTAAGA
TTATCGTTTG GGCTGTAAAC ATATTCATAA CCTGTTATTT CTGCTGCTGC ATTATGGGTC TGTGATTTTG TTGGAGGGCT
GTAGTCAGGC TAGCCTTTGA CTGGTTCTGG TATAAAAATG GATTGAAAAG CCAAACATAA AGCCTGGTTT TGTTTTAAGG
TTTCATGGAA GCTGGCTTAC TTTGTATAAA CTTGTTATTT TCAAAAATCA ATCACTTCTA GATTGCACAT TGTTGAGCCA
TGCATTTTCT TTCCTTTTGC TTTTCAACCT TTAATACCAT TTCTGTATCA TGATATATTT GTTCCCCTTA CTTTTGGTTT
TCCTGCTATT CTTGATCGGT AACCATTGGT AGCCATATTA GTAATATTGA AAAGTTATTT TTGGATGAAT ATAATGGTGC
AAGCAAATCT CACTGGAGCA TTATTTTCTT GACAGTTTGA AGGCATGTAG GACGAGGAGT GTGATAGCAT CTAGGAAGGA
GAACCATCGT TTTTAGGGAA AGAACGCTCC AGCATCCTGT TATGTTGTAA GCAGGATGCT TCTAAAGTTC CAATACCTTG
TTACCACGAA TGTTAGTCGT CGTTCTTTTT GAAATGTTCT TGTGTTAGCC AGGATGTCCA AATTTGTTGT AGGTTCTAGT
TCAGTCGTGT GTTGTGTGGT TGTGTCTAAC CATATTTGGC CGTTTCCGGC TGTCCTGCAT ATGCTAAATT CAGAGGGGTA
AAGAGATCT

Locus: Os05g0573500

Loading...

Locus: Os05g0573500

Loading...