Os05t0574500-01

Locus

Os05g0574500

Description

Ras-like nuclear GTPase, Regulation of cell division during cold stress, Cold tolerance, Abiotic stress response

RAP-DB Gene Symbol Synonym(s)

OsRAN2

RAP-DB Gene Name Synonym(s)

Ras-like nuclear GTPase 2, Ras-related nuclear protein 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRAN2, RAN2

Oryzabase Gene Name Synonym(s)

Spi-1 protein, Transforming protein (ras), Ran GTPase 2, Ras-like nuclear GTPase 2, Ras-related nuclear protein 2

Transcript Evidence

AK121699

AK061714

AK098889

Protein Evidence

Q7GD79

Literature

PMID: 20825577

PMID: 20018899

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

October 22, 2020

Gene Ontology (GO)

Biological Process: nucleocytoplasmic transport (GO:0006913)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Small GTPase (IPR001806)

Ran GTPase (IPR002041)

Small GTP-binding protein domain (IPR005225)

Experimentally confirmed subcellular location

nucleus (GO:0005634) [mainly] [interphase]

cytoplasm (GO:0005737) [interphase]

spindle (GO:0005819) [mitotic phase]

tubulin complex (GO:0045298) [mitotic phase]

Full-length cDNA

J033073D17 (Online Clone Ordering)

001-037-H05 (Online Clone Ordering)

J013001L15 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0574500-01)

Others

Oryzabase (17710)

Transcript

1030 bp

>Os05t0574500-01 Ras-like nuclear GTPase, Regulation of cell division during cold stress, Cold tolerance, Abiotic stress response
ATTCCATTTCGAATTCTAGGGTTTTGTTGGCCCCCATTCCTCCCCCACCCCGGTGTCCTC
CCCTCCGCCGCTCGCGTCGCCGCCTTTTTCCCCTATGGCGCTGCCGAATCAGGGGACCGT
GGATTACCCCAGCTTCAAGCTGGTCATCGTCGGCGATGGCGGGACTGGTAAAACTACATT
TGTGAAGAGGCATCTCACTGGAGAGTTTGAAAAGAAATATGAGCCAACCATTGGTGTCGA
AGTTCACCCTCTAGATTTTACCACCAACTGTGGTAAGATCCGCTTCTACTGCTGGGACAC
TGCTGGACAAGAGAAGTTTGGTGGACTTAGGGATGGATACTATATCCATGGTCAATGTGC
GATAATTATGTTTGATGTCACTTCAAGGCTGACTTACAAGAATGTTCCAACATGGCATAG
GGACTTGTGCAGGGTGTGTGAAAACATCCCCATTGTCCTGTGTGGTAACAAGGTTGATGT
GAAGAACAGGCAGGTTAAAGCCAAGCAGGTCACATTCCACAGGAAGAAGAATCTCCAGTA
CTATGAAATTTCTGCCAAGAGCAACTACAACTTTGAGAAGCCCTTCCTTTATCTTGCAAG
GAAGCTTGCTGGTGACCCGAACCTGCATTTCGTTGAAGCTGTTGCTCTTAAACCTCCGGA
AGTTCCCATTGACCTGGCAATGCAGCAACAGCATGAGGCTGAGCTTGCGGCTGCAGCAGC
ACAACCTCTCCCAGATGACGATGACGATCTGATCGAGTAGAGAGGATCATGAGTCTATCA
TGCTTCAGCCTGAGTCTCTTCATAAGAGTCTGAATTAGGCCAATGCATGCTAGTGTTAGC
TTGTCTGTGGAATGTGGACGTTTCCTGCGTGCCTGATGGGTTGAAAACTTTTGATGTGTG
GTGTTACATGTTGCTGCCATGAATTTGTTGGCTCTTTTTTAACACTGCTGTGTTACTTCT
ATGGTTATGCTTAAACTATTTGTATCATCGAGCTGGTATTTATTTATCCGGTGTTGCACA
ATATTCTTCT

CDS

666 bp

>Os05t0574500-01 Ras-like nuclear GTPase, Regulation of cell division during cold stress, Cold tolerance, Abiotic stress response
ATGGCGCTGCCGAATCAGGGGACCGTGGATTACCCCAGCTTCAAGCTGGTCATCGTCGGC
GATGGCGGGACTGGTAAAACTACATTTGTGAAGAGGCATCTCACTGGAGAGTTTGAAAAG
AAATATGAGCCAACCATTGGTGTCGAAGTTCACCCTCTAGATTTTACCACCAACTGTGGT
AAGATCCGCTTCTACTGCTGGGACACTGCTGGACAAGAGAAGTTTGGTGGACTTAGGGAT
GGATACTATATCCATGGTCAATGTGCGATAATTATGTTTGATGTCACTTCAAGGCTGACT
TACAAGAATGTTCCAACATGGCATAGGGACTTGTGCAGGGTGTGTGAAAACATCCCCATT
GTCCTGTGTGGTAACAAGGTTGATGTGAAGAACAGGCAGGTTAAAGCCAAGCAGGTCACA
TTCCACAGGAAGAAGAATCTCCAGTACTATGAAATTTCTGCCAAGAGCAACTACAACTTT
GAGAAGCCCTTCCTTTATCTTGCAAGGAAGCTTGCTGGTGACCCGAACCTGCATTTCGTT
GAAGCTGTTGCTCTTAAACCTCCGGAAGTTCCCATTGACCTGGCAATGCAGCAACAGCAT
GAGGCTGAGCTTGCGGCTGCAGCAGCACAACCTCTCCCAGATGACGATGACGATCTGATC
GAGTAG

Protein

221 aa

>Os05t0574500-01 Ras-like nuclear GTPase, Regulation of cell division during cold stress, Cold tolerance, Abiotic stress response
MALPNQGTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFTTNCG
KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPI
VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV
EAVALKPPEVPIDLAMQQQHEAELAAAAAQPLPDDDDDLIE*

5'UTR

chr05:28624646..28624739 (- strand) : 94 bp

CDS

chr05:28624643..28624645 (- strand) : 3 bp

chr05:28624481..28624550 (- strand) : 70 bp

chr05:28623787..28623843 (- strand) : 57 bp

chr05:28623584..28623701 (- strand) : 118 bp

chr05:28623377..28623466 (- strand) : 90 bp

chr05:28623115..28623294 (- strand) : 180 bp

chr05:28622930..28623007 (- strand) : 78 bp

chr05:28622762..28622831 (- strand) : 70 bp

3'UTR

chr05:28622492..28622761 (- strand) : 270 bp

FASTA

>Os05t0574500-01 class=Sequence position=chr05:28622492..28624739 (- strand)
ATTCCATTTC GAATTCTAGG GTTTTGTTGG CCCCCATTCC TCCCCCACCC CGGTGTCCTC CCCTCCGCCG CTCGCGTCGC
CGCCTTTTTC CCCTATGGTG AGTACGATCT CGATTTCGCC GCGCCGTGTG GGTTTGGATC TCGGGGTTCC TGTGTTTGAT
CCGCGACGTT TTTTGGCTTT TTTTTCCAGG CGCTGCCGAA TCAGGGGACC GTGGATTACC CCAGCTTCAA GCTGGTCATC
GTCGGCGATG GCGGGACTGG TGAGTTCCCA ATCTCGATTC GGATCCTATT CCGTTCTGAA ACGGCATGTT ATGATATGTT
TGATGCGTCT ACTCGGTGTG GTTTCTACTA GATCTGATGG GCTAAGATTT GTACCGGTGG CTGAAATCCG ATGGATTTTT
TTTTATTTCG CCATTAGACT GGGATTTGGG TATTGGATGT TTCCATTTTA TGATTCAGCT TATCCCAGGG ATGGGTTATT
GCTCTATTTT TATATGACGT CTAAAATTTT GCTACTCCTA TCTTGATGAT TAGGATCTTG AGAGTTATTT TAGGATATTG
AAATCGGCAT AAATATGATG CTATACAGGT CGTATTTAGT CAGATGTATT TATTATCTTA TTTTAGAATG GACCATCGTG
CTATGCTGTT ATTCTAGGAT TCGCCTGGGA CTGAATAAAT TTGAGGAAAA AGTAAAATAG TATATAAATA CCTTCGCATC
AGTAAACTAT TGCGCTTTTT GATCAGTTGA GATTGGTCAA AACATTAGTT GCAGTCTGAT TAGTTTAGGC CGGCAATATG
CCTGAATGGC TTCATTTCCG TAAGAAAAGT TTACTTATTG CCTTCTATAT CATTGTTATT GGATGGATTT TGATGGTATG
CCATGTTTGA TTGCAGGTAA AACTACATTT GTGAAGAGGC ATCTCACTGG AGAGTTTGAA AAGAAATATG AGCGTATGTA
CTATGACTCT TATTTTTGTT GTTCCTGTAT TCTTTGCTAA ATTAGTTATT GAACTGTTAT GCAAATTTGT CACTTCAGCA
ACCATTGGTG TCGAAGTTCA CCCTCTAGAT TTTACCACCA ACTGTGGTAA GATCCGCTTC TACTGCTGGG ACACTGCTGG
ACAAGAGAAG TTTGGTGGAC TTAGGGATGG ATACTAGTAA GTGCTAGAGA AGTGCTTAAG CCAATTATCA TAGCTTCCCT
TAATATTTTT CCATGCATAT GGATGTCTCC TTGTGCTTGC CTGATTGTTC TGTCCTTAAC TTCTGTTGTG CAGTATCCAT
GGTCAATGTG CGATAATTAT GTTTGATGTC ACTTCAAGGC TGACTTACAA GAATGTTCCA ACATGGCATA GGGACTTGTG
CAGGTTTATT TCTGAAGACA CGATAAACTT TACCTAATAT ATTATATGGA AGAGAACTCT TATGATTAGG TATCAACTCT
TGCAGGGTGT GTGAAAACAT CCCCATTGTC CTGTGTGGTA ACAAGGTTGA TGTGAAGAAC AGGCAGGTTA AAGCCAAGCA
GGTCACATTC CACAGGAAGA AGAATCTCCA GTACTATGAA ATTTCTGCCA AGAGCAACTA CAACTTTGAG AAGCCCTTCC
TTTATCTTGC AAGGAAGCTT GCTGGGTAAT AATTCCCTCC TTATTGTTTT CCTTTTCATG CTTTCTTCTT ACATTGTTTG
TGTTTATTAT GCAACATATT TTAATCTGTG TTAATGCTTT TGGTGTATGT AGTGACCCGA ACCTGCATTT CGTTGAAGCT
GTTGCTCTTA AACCTCCGGA AGTTCCCATT GACCTGGCAA TGCAGCAACA GTAAGTGTTT ATGCTTTGTC CAATTCATTT
TCAGATAGTG TTGATGAAAT ACCTAGTTTC TGCAAACATT TCAGGAACTA ATTTTAATAC TCATGCAGGC ATGAGGCTGA
GCTTGCGGCT GCAGCAGCAC AACCTCTCCC AGATGACGAT GACGATCTGA TCGAGTAGAG AGGATCATGA GTCTATCATG
CTTCAGCCTG AGTCTCTTCA TAAGAGTCTG AATTAGGCCA ATGCATGCTA GTGTTAGCTT GTCTGTGGAA TGTGGACGTT
TCCTGCGTGC CTGATGGGTT GAAAACTTTT GATGTGTGGT GTTACATGTT GCTGCCATGA ATTTGTTGGC TCTTTTTTAA
CACTGCTGTG TTACTTCTAT GGTTATGCTT AAACTATTTG TATCATCGAG CTGGTATTTA TTTATCCGGT GTTGCACAAT
ATTCTTCT

Locus: Os05g0574500

Loading...

Locus: Os05g0574500

Loading...