Os05t0576800-01

Locus

Os05g0576800

Description

Similar to Blast and wounding induced mitogen-activated protein kinase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMPK17, OsMPK21-1

Oryzabase Gene Name Synonym(s)

Mitogen-activated protein kinase 17, MAP kinase 21-1

Transcript Evidence

AK070644 (DDBJ, Best hit)

Protein Evidence

Q6L5F7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

MAP kinase, conserved site (IPR003527)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J023062F11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0576800-01)

RiceXPro (AK070644)

Others

Oryzabase (9262)

KEGG (Os05t0576800-01)

Transcript

2145 bp

>Os05t0576800-01 Similar to Blast and wounding induced mitogen-activated protein kinase.
GCGCGCGCGGCGCGCGCGGCGTCCCCGATGCTCGACCACCACCGCACGAGGGCCGGTTTA
TGGGCGGCCGCGCCCGCTCCATCCTACGCTGGCTCCGTCACCACCGCTCCCGCCGCGTCT
CCTCCTCTTCCTTCCATCTGACCACCACCGGTGACGACACCGTCAAGGATCTCCACGACC
CGCGGCGAGAGGACGCGGAGGGCGACGGGTGGGAGGAGGTCCACGAGGGCCCCGAGTCCG
ACCCCGAGGAGTACATTGCGTTGGTGTCGGAGGACGCGGGCACGCACCTGCCGGTGCGCA
CGGAGCCGCGACGCATGGATCCGAGCAAGAAGGAACCTGACTTCTTCACTGAATATGGTG
AAGCAAACCGGTATAAAGTCAGTGAAGTCATTGGCAAAGGGAGTTATGGTGTTGTGGCTG
CCGCTGTCGACACCCAGACCGGCGAGCGAGTGGCGATCAAGAAGATCAATGATGTTTTCG
ATCATGTCTCTGATGCCACCCGCATCCTTAGGGAGATTAAGTTGCTCCGGTTGCTGCGTC
ACCCAGACATAGTTGAGATCAAGCACATAATGCTTCCTCCTTCAAGGAGGGAATTCAGGG
ACATTTATGTAATCTTTGAGCTAATGGAGTCAGATCTCCATCAGGTAATAAAAGCAAATG
ATGATCTCACACCAGAGCATCACCAGTTTTTCTTGTATCAGCTGCTCCGGGGAATGAAGT
ACATTCATGCAGCAAGTGTTTTCCATCGGGATCTTAAGCCCAAGAATATTCTAGCCAATG
CTGATTGCAAGCTGAAGGTTTGCGATTTCGGCCTTGCCCGAGTGTCATTTAACGATACCC
CATCAGCCATATTCTGGACGGATTATGTGGCAACTAGATGGTATCGTGCCCCAGAGTTGT
GTGGCTCCTTTTTTTCAAAGTACACCCCTGCAATTGATATTTGGAGTGTAGGATGTATAT
TTGCAGAGCTGCTTACAGGAAAGCCACTCTTTCCAGGGAAAAATGTTGTGCATCAATTGG
ATCTCATGACTGATCTACTTGGCACTCCTTCAGCAGAATCCCTTGCTAAGATACGGAATG
AGAAAGCTCGACGATACCTGAGCAACATGAGGAAAAAGCCTCGGGTTCCTTTTACTAAAA
AATTTCCAGGTGTGGATCCTATGGCTCTCCATTTGCTTGAACGCCTTCTTGCTTTTGATC
CCAAAGATCGTCCAAGTGCAGAAGAGGCCCTGACAGACCCCTACTTTAATGGGCTAGCAA
ACTCTGAACGCGAACCAATAGCACAGCCTATCTCAAAGCTTGAGTTTGAGTTCGAGAAGA
GGAAATTGGCCAAAGATGATGTCCGGGAATTAATTTACCGAGAGATTTTAGAGTATCATC
CCCATATGCTGCAAGAATATTTGCGCGGGGGAGACCAGATGAGTTTCATGTATCCTAGTG
GGGTGGATCGCTTCAAGCGTCAATTCGCTCATTTGGAGGAAGGAGTTTCAAAGGGTGAAA
AATCCAGTCCACAGCTTCGGCAGAATGCTTCCTTACCAAGGGAAAGAGCAATTGGTAACA
AGCATGGAGATGACGAGTACCACGCAAAGCTGAATGTAGGCGAGAAGCCATGCCATGCAT
CAGTGACAGACGGCATTAGCAAACCGCTCATGAGTGCTCGGAGCTTGTTGAAGAGTGAAA
GCATAAGCGCTTCCAAGTGTATTGGTGAAAAACCAAAGCAAGACAGAGATCAGGAGGATT
CCCTTACAGAGAGCATGGACGAAACAGCTGATGAGGTCTCAGAAAAGGTTGCTCAACTGA
AAACCTGATGATTCCCGTCAAGGTCACAGAATCGATCGGAGTTAGTACAACAGCATGTGT
ATAGATGCCCTTCCCCAGAAGACGAGAATCCCAGATCAGGACGGTCTTAACCATGATAAA
GAGTCTACAACTAATAATACCACAAGTTGTTTTGGTAACCTCTGTTGTACTGTAAATTTT
TCCCCCTTCAGTTTTGTGTTTTGACAGCAAACAACTGTCTAACTGACTGGTTAGTTCCTC
GTCTTTTCCTCGATGGGACAATCACCGATCCTGTAAAATTTCCTTTCTTTTGATGACAGA
ATCATACACTGTTTCTATGATATATTCTAAAATTTTGCAGTCAAT

CDS

1749 bp

>Os05t0576800-01 Similar to Blast and wounding induced mitogen-activated protein kinase.
ATGGGCGGCCGCGCCCGCTCCATCCTACGCTGGCTCCGTCACCACCGCTCCCGCCGCGTC
TCCTCCTCTTCCTTCCATCTGACCACCACCGGTGACGACACCGTCAAGGATCTCCACGAC
CCGCGGCGAGAGGACGCGGAGGGCGACGGGTGGGAGGAGGTCCACGAGGGCCCCGAGTCC
GACCCCGAGGAGTACATTGCGTTGGTGTCGGAGGACGCGGGCACGCACCTGCCGGTGCGC
ACGGAGCCGCGACGCATGGATCCGAGCAAGAAGGAACCTGACTTCTTCACTGAATATGGT
GAAGCAAACCGGTATAAAGTCAGTGAAGTCATTGGCAAAGGGAGTTATGGTGTTGTGGCT
GCCGCTGTCGACACCCAGACCGGCGAGCGAGTGGCGATCAAGAAGATCAATGATGTTTTC
GATCATGTCTCTGATGCCACCCGCATCCTTAGGGAGATTAAGTTGCTCCGGTTGCTGCGT
CACCCAGACATAGTTGAGATCAAGCACATAATGCTTCCTCCTTCAAGGAGGGAATTCAGG
GACATTTATGTAATCTTTGAGCTAATGGAGTCAGATCTCCATCAGGTAATAAAAGCAAAT
GATGATCTCACACCAGAGCATCACCAGTTTTTCTTGTATCAGCTGCTCCGGGGAATGAAG
TACATTCATGCAGCAAGTGTTTTCCATCGGGATCTTAAGCCCAAGAATATTCTAGCCAAT
GCTGATTGCAAGCTGAAGGTTTGCGATTTCGGCCTTGCCCGAGTGTCATTTAACGATACC
CCATCAGCCATATTCTGGACGGATTATGTGGCAACTAGATGGTATCGTGCCCCAGAGTTG
TGTGGCTCCTTTTTTTCAAAGTACACCCCTGCAATTGATATTTGGAGTGTAGGATGTATA
TTTGCAGAGCTGCTTACAGGAAAGCCACTCTTTCCAGGGAAAAATGTTGTGCATCAATTG
GATCTCATGACTGATCTACTTGGCACTCCTTCAGCAGAATCCCTTGCTAAGATACGGAAT
GAGAAAGCTCGACGATACCTGAGCAACATGAGGAAAAAGCCTCGGGTTCCTTTTACTAAA
AAATTTCCAGGTGTGGATCCTATGGCTCTCCATTTGCTTGAACGCCTTCTTGCTTTTGAT
CCCAAAGATCGTCCAAGTGCAGAAGAGGCCCTGACAGACCCCTACTTTAATGGGCTAGCA
AACTCTGAACGCGAACCAATAGCACAGCCTATCTCAAAGCTTGAGTTTGAGTTCGAGAAG
AGGAAATTGGCCAAAGATGATGTCCGGGAATTAATTTACCGAGAGATTTTAGAGTATCAT
CCCCATATGCTGCAAGAATATTTGCGCGGGGGAGACCAGATGAGTTTCATGTATCCTAGT
GGGGTGGATCGCTTCAAGCGTCAATTCGCTCATTTGGAGGAAGGAGTTTCAAAGGGTGAA
AAATCCAGTCCACAGCTTCGGCAGAATGCTTCCTTACCAAGGGAAAGAGCAATTGGTAAC
AAGCATGGAGATGACGAGTACCACGCAAAGCTGAATGTAGGCGAGAAGCCATGCCATGCA
TCAGTGACAGACGGCATTAGCAAACCGCTCATGAGTGCTCGGAGCTTGTTGAAGAGTGAA
AGCATAAGCGCTTCCAAGTGTATTGGTGAAAAACCAAAGCAAGACAGAGATCAGGAGGAT
TCCCTTACAGAGAGCATGGACGAAACAGCTGATGAGGTCTCAGAAAAGGTTGCTCAACTG
AAAACCTGA

Protein

583 aa

>Os05t0576800-01 Similar to Blast and wounding induced mitogen-activated protein kinase.
MGGRARSILRWLRHHRSRRVSSSSFHLTTTGDDTVKDLHDPRREDAEGDGWEEVHEGPES
DPEEYIALVSEDAGTHLPVRTEPRRMDPSKKEPDFFTEYGEANRYKVSEVIGKGSYGVVA
AAVDTQTGERVAIKKINDVFDHVSDATRILREIKLLRLLRHPDIVEIKHIMLPPSRREFR
DIYVIFELMESDLHQVIKANDDLTPEHHQFFLYQLLRGMKYIHAASVFHRDLKPKNILAN
ADCKLKVCDFGLARVSFNDTPSAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSVGCI
FAELLTGKPLFPGKNVVHQLDLMTDLLGTPSAESLAKIRNEKARRYLSNMRKKPRVPFTK
KFPGVDPMALHLLERLLAFDPKDRPSAEEALTDPYFNGLANSEREPIAQPISKLEFEFEK
RKLAKDDVRELIYREILEYHPHMLQEYLRGGDQMSFMYPSGVDRFKRQFAHLEEGVSKGE
KSSPQLRQNASLPRERAIGNKHGDDEYHAKLNVGEKPCHASVTDGISKPLMSARSLLKSE
SISASKCIGEKPKQDRDQEDSLTESMDETADEVSEKVAQLKT*

5'UTR

chr05:28721012..28721070 (+ strand) : 59 bp

CDS

chr05:28721071..28721343 (+ strand) : 273 bp

chr05:28722259..28722658 (+ strand) : 400 bp

chr05:28722742..28722869 (+ strand) : 128 bp

chr05:28722959..28723018 (+ strand) : 60 bp

chr05:28723191..28723340 (+ strand) : 150 bp

chr05:28723712..28723867 (+ strand) : 156 bp

chr05:28723974..28724111 (+ strand) : 138 bp

chr05:28724200..28724273 (+ strand) : 74 bp

chr05:28724498..28724599 (+ strand) : 102 bp

chr05:28725741..28725930 (+ strand) : 190 bp

chr05:28726079..28726156 (+ strand) : 78 bp

3'UTR

chr05:28726157..28726493 (+ strand) : 337 bp

FASTA

>Os05t0576800-01 class=Sequence position=chr05:28721012..28726493 (+ strand)
GCGCGCGCGG CGCGCGCGGC GTCCCCGATG CTCGACCACC ACCGCACGAG GGCCGGTTTA TGGGCGGCCG CGCCCGCTCC
ATCCTACGCT GGCTCCGTCA CCACCGCTCC CGCCGCGTCT CCTCCTCTTC CTTCCATCTG ACCACCACCG GTGACGACAC
CGTCAAGGAT CTCCACGACC CGCGGCGAGA GGACGCGGAG GGCGACGGGT GGGAGGAGGT CCACGAGGGC CCCGAGTCCG
ACCCCGAGGA GTACATTGCG TTGGTGTCGG AGGACGCGGG CACGCACCTG CCGGTGCGCA CGGAGCCGCG ACGCATGGAT
CCGAGCAAGA AGGTGGGGAT GGCCTTCTCT TCTCTTCTCC CCTGAATGCT TTTCTTGGAT TCTTGTGGTT TCTTGGATTC
CTCTGAACTG TTATTTACTA GTAGTAACTG TTTACTGCAT GAATGAATGG TAAATGCTCT ACATGGAGTT GCGATCTCTG
TTTCATGAGA TTGCGTTGTT GCCGGTTAGT GTGGATCTGG TTCCATCTCT CATTTGAACG ATACGTTTGC AATCCATGGC
ATGTTCATTC ACATGCTTAC ATAAGCCAAC GCGCGGAATC ATTGCTGATG TGATGCTGAT ATAGTACTTA CATGAGTGCT
GTCAATTCAG GAATCCAAGA TAACCGAGTA TGTCAATTCA GGATAACTAA GTATGAATCC AAGATAACCA AGTATGCCAA
TTCAGGAACC CTTTATTCCA GATAAAGGTA GAGCTTTACG GAAACTAAAG GCATAATTCT GCGGGCAGTA GTTCATATTG
GAAAATGGGG CCTACTGCTT TTCTTGCTTC TGTCTCGTTT GGGAAAAACC AAAATTCAGT AACAGCTGCT TTTATTTTGA
CTTTTCACAA TGTACAGATT TATTTTCGTT CTTTCAGAAA AAAAAAGGGG GGGGGGGGGG GGGGGAAGGG CGTACAGATA
AGGTTTGTCA CTGTACTTGG AAGAATCAGA TTGCAAAATT TATTGATGCT CGGTCACTAT CTAATTTACA TATCTAATGC
AATCTAAATC TGCATGTCTT TAGTACATTT TACAGTAGTC CTAATGCCCT TGAAGTTCCT TTTCTTATCT GTTGCACATC
ACATTGTTTG TACCCGGGTG TTTTCAAGGC ACAAGGTTTC GTTCCCAAGA AATATGTCAT CAACCCGTTC ATACCACCTA
GCATTCAGTA CTGTTACTAT AGTGAACTTT ACCTTCTTCC ATTCCAGGAA CCTGACTTCT TCACTGAATA TGGTGAAGCA
AACCGGTATA AAGTCAGTGA AGTCATTGGC AAAGGGAGTT ATGGTGTTGT GGCTGCCGCT GTCGACACCC AGACCGGCGA
GCGAGTGGCG ATCAAGAAGA TCAATGATGT TTTCGATCAT GTCTCTGATG CCACCCGCAT CCTTAGGGAG ATTAAGTTGC
TCCGGTTGCT GCGTCACCCA GACATAGTTG AGATCAAGCA CATAATGCTT CCTCCTTCAA GGAGGGAATT CAGGGACATT
TATGTAATCT TTGAGCTAAT GGAGTCAGAT CTCCATCAGG TAATAAAAGC AAATGATGAT CTCACACCAG AGCATCACCA
GTTTTTCTTG TATCAGCTGC TCCGGGGAAT GAAGTACATT CATGCAGGTA GTAGATTCCA TATAGTAGGA AATCGGTAAT
TTCTTTTGCT TATGTGGTTG ACACGCTCAC TTTCTGGTTT CTCTTTGCAG CAAGTGTTTT CCATCGGGAT CTTAAGCCCA
AGAATATTCT AGCCAATGCT GATTGCAAGC TGAAGGTTTG CGATTTCGGC CTTGCCCGAG TGTCATTTAA CGATACCCCA
TCAGCCATAT TCTGGACGGT TAGGCATTTA TTAATGTTGA GAAGATATTT CTTAACAATG AACAGCCATA TCTTGGCATC
TAATGAATTT TCCATGCTTC GTTCTAGGAT TATGTGGCAA CTAGATGGTA TCGTGCCCCA GAGTTGTGTG GCTCCTTTTT
TTCAAAGGTA AGGGAATTTC CATTTAACAT GGTGATGGCT ATATTATTTT TTCTTCCAAC ATTGTTATAT TACTATGATA
TGTTTGGATC AATGTAGCAA CAGTGTTTTG AGAATGTTCT CTTAGACATT GTCGCATTAG GTGATATCTT GATTTATATT
TTGTCATTGG CTTTTGCAGT ACACCCCTGC AATTGATATT TGGAGTGTAG GATGTATATT TGCAGAGCTG CTTACAGGAA
AGCCACTCTT TCCAGGGAAA AATGTTGTGC ATCAATTGGA TCTCATGACT GATCTACTTG GCACTCCTTC AGCAGAATCC
CTTGCTAAGG TATATTCAAT CCTTGCAAGC TTGTGCCTTC ACTCAAGTGC AATGTATTGA CTCCTCACTA GTCTGTGTGT
TCACTTCTTT ATGCAGAATT CTTCGCAACT ATATTTAATA TTTAAGCTTG GCATCAGCCT CTGTTTCATA TTTCTGTACA
AATTTCCTCC AAAATCACTA ACAGTGAATC ATATAGTTCA TATAGTTATT AATGTACTGT TTTGAGTGGT ATATTTTCCT
GAGCGACTTC ATATTGCATT CATAGTGCAC AAGGACAGAC TCTATTTTCT TCCATGTATT TGTTGTAAAA AAACGAGGTG
TAAATTGTAG AAATAATGCA TATTGATGTG CTTTACATTC ATTTATTGAA TGGGTTGCAG ATACGGAATG AGAAAGCTCG
ACGATACCTG AGCAACATGA GGAAAAAGCC TCGGGTTCCT TTTACTAAAA AATTTCCAGG TGTGGATCCT ATGGCTCTCC
ATTTGCTTGA ACGCCTTCTT GCTTTTGATC CCAAAGATCG TCCAAGTGCA GAAGAGGTAG GAGTGTTCAC AGCCAACTTA
TGTTGATTGT AAAGACATTC CAGCTTTGAA ATGTTGGATA CATTGCTATC CTGAATACTG AGATATGGAA TTATTATTCA
AGGCCCTGAC AGACCCCTAC TTTAATGGGC TAGCAAACTC TGAACGCGAA CCAATAGCAC AGCCTATCTC AAAGCTTGAG
TTTGAGTTCG AGAAGAGGAA ATTGGCCAAA GATGATGTCC GGGAATTAAT TTACCGAGAG GTGCCACTGA TGAATTCTTT
TGTGAATATT ACGACAGAGC TGCCACTTGA CTCTTTACTG TACTAATATA CTTGTTAAAT CTCTTTAGAT TTTAGAGTAT
CATCCCCATA TGCTGCAAGA ATATTTGCGC GGGGGAGACC AGATGAGTTT CATGTATCCT AGGTAACTCC AGTATTTCTT
TTACGAAGTT GATCACCTGT TGGCATATTT TATGGTAACT AATTCACTGT TCTGTATTGT TGCATCCCAC AAACATAAAT
CAATATGCTG TATTAAATTA GTGACTTATG CTAAATAATC ACACAAAAAA AATTGCTACA CGTTAGGTCA AGGACATATT
CAAGTGGTAA TTCTGATGTC TGTTTATATA TGTTGGATCT TGACAGTGGG GTGGATCGCT TCAAGCGTCA ATTCGCTCAT
TTGGAGGAAG GAGTTTCAAA GGGTGAAAAA TCCAGTCCAC AGCTTCGGCA GAATGCTTCC TTACCAAGGT AATATACAAT
CACCCCTGAA ATATGTCTTT GTATATGTAG TGAGCCAGAT AGCAACTGGA GACGGGGACT GCTAATGCGC GGGTGATCGC
TGGGACCAAT CACCCGCAcc cccctcccct atacgtccct cttctccccc ttcctcctcc cttttttctc ttccctacta
cagtacacca caaaattgtt tttaaaaaac aaaagttaga aaaatttatg taaagaaata ttatatataa aaaaatttga
attcaaattc aaatttgaat caggtatgta aacttttgac ttataaactt tggatctaaa gtaggtgtat aaactttaga
tgtatagaaa tactatatat agaaaatatt tgaattcaaa tccaaattta aatcagatat aattcaattc aaatttgaaa
cgggtatata aacttttgac ttataaactt taggtctata aactttagat ctataaactt taggtctata aactttagat
gtatagaaat actatatata aaaaatattt gaattcaaat tcaaatttga atcggatata taaacttttg acttataaac
ttttggtctc taaactttag atgtataaac ttgaggtgta taaactttat gtgcataaat ttactaaaat aGGaaagtaa
tgcggtgcca aaaaaggaaa ccaggtggag ggagggggga actgatcgct accagttggc cctggcgatt gatcgcgaat
cagcctttcc gaCTGGAGAC TTCTGAGCTG AATTGTTTGT CTTTTACCAA CATCTTCTTA AGGAAGTTTT TTATTCCAAC
AAGGCAGGGG CATTGATTGT TTAGGCATGT AGCATATGAC TAGATGGCAT GGTATTGAGT TCAATGTTTT CTGTGCATCT
CAGGAGTTCT TTTTTCAGGA ATACATATAG GATTTGTGTA TCTTTTTATT AAGCCAGGAT AGTTAATATG TTACATTTAC
ATGCCTTGAA AAGGAAAAAT GATGGGAAGA AGGCAAACAA GAACTAGAAA ATGTTAATTC CAAGAGTACA AAAGAGTGAT
GCGCATCTCA GGAGTAATCA GAAGACCTAT AAGTTGAAAA TCACTCTTCT GTGCCCTTGG AATTAACATT TTTCTGCGTC
TTTTTTCAGG GAAAGAGCAA TTGGTAACAA GCATGGAGAT GACGAGTACC ACGCAAAGCT GAATGTAGGC GAGAAGCCAT
GCCATGCATC AGTGACAGAC GGCATTAGCA AACCGCTCAT GAGTGCTCGG AGCTTGTTGA AGAGTGAAAG CATAAGCGCT
TCCAAGTGTA TTGGTGAAAA ACCAAAGCAA GACAGAGATG TAAGTGTAGT ATCTCATTCC TGCACCACAC ATGTCAGGAC
GGTTCCTGTT TGTCGAGGAA GGAAACAATA TATGTTCTAG TCTATCTAAT TTTTTATTTA CGTAAGATTT AAAATAAAAT
TTTGACATAA GATAGTCTAT TTCTCAGCAG GAGGATTCCC TTACAGAGAG CATGGACGAA ACAGCTGATG AGGTCTCAGA
AAAGGTTGCT CAACTGAAAA CCTGATGATT CCCGTCAAGG TCACAGAATC GATCGGAGTT AGTACAACAG CATGTGTATA
GATGCCCTTC CCCAGAAGAC GAGAATCCCA GATCAGGACG GTCTTAACCA TGATAAAGAG TCTACAACTA ATAATACCAC
AAGTTGTTTT GGTAACCTCT GTTGTACTGT AAATTTTTCC CCCTTCAGTT TTGTGTTTTG ACAGCAAACA ACTGTCTAAC
TGACTGGTTA GTTCCTCGTC TTTTCCTCGA TGGGACAATC ACCGATCCTG TAAAATTTCC TTTCTTTTGA TGACAGAATC
ATACACTGTT TCTATGATAT ATTCTAAAAT TTTGCAGTCA AT