Os05t0580500-02

Locus

Os05g0580500

Description

Rice homolog of yeast REC8, OsRad21-4 protein, Meiotic processes

RAP-DB Gene Symbol Synonym(s)

REC8, OsREC8, OsRad21-4

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAD21-4

CGSNL Gene Name

RAD21-4 PROTEIN

Oryzabase Gene Symbol Synonym(s)

OsRad21-4, REC8, OsREC8, OsRAD21-4

Oryzabase Gene Name Synonym(s)

Rad21-4 protein, RECombination 8

Transcript Evidence

AY371049 (Zhonghua 10)

Protein Evidence

Q6UFU7

Literature

PMID: 30610223

PMID: 21606318

PMID: 16525890

Note

Manual Curation

March 28, 2019

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Winged helix DNA-binding domain superfamily (IPR036390)

Rad21/Rec8-like protein, N-terminal (IPR006910)

Rad21/Rec8-like protein, C-terminal, eukaryotic (IPR006909)

Others

Oryzabase (6886)

Transcript

2101 bp

>Os05t0580500-02 Rice homolog of yeast REC8, OsRad21-4 protein, Meiotic processes
CAGCGCCTCCACTCTCACTCGCTCATCCATTCCCTCCCTCCTCACGATCGAGAATGTTCT
ACTCGCACCAGCTCCTCGCGCGGAAGGCTCCGCTCGGCCAGATATGGATGGCGGCGACGC
TTCACTCGAAGATCAACCGGAAGCGGCTTGACAAGCTCGACATCATCAAAATCTGTGAGG
AGATTTTGAACCCGTCGGTACCCATGGCACTAAGGCTCTCCGGAATTCTCATGGGTGGTG
TGGCGATCGTGTACGAGAGGAAGGTGAAGGCTCTGTATGATGATGTGTCTCGGTTTCTGA
TTGAGATCAACGAGGCATGGCGGGTCAAGCCAGTCGCAGACCCCACCGTACTTCCCAAGG
GCAAAACCCAAGCCAAGTATGAAGCAGTAACACTGCCAGAGAATATCATGGATATGGATG
TGGAGCAGCCCATGCTTTTCTCAGAGGCTGATACTACAAGGTTCCGGGGAATGCGTTTGG
AGGATTTGGATGACCAATACATTAATGTCAACCTAGACGATGATGACTTCTCGCGCGCTG
AGAATCATCACCAAGCTGATGCAGAAAATATCACCCTGGCTGATAATTTCGGGTCTGGGC
TTGGAGAGACTGATGTGTTCAATCGTTTTGAGAGATTCGACATAACAGATGATGATGCAA
CTTTCAATGTCACTCCTGATGGACACCCACAGGTTCCAAGTAATCTGGTTCCTTCTCCAC
CTAGGCAGGAAGACTCTCCTCAGCAACAAGAAAACCATCATGCTGCCTCATCCCCTCTTC
ACGAAGAAGCTCAACAAGGGGGGGCATCTGTAAAAAATGAGCAAGAGCAGCAGAAGATGA
AGGGTCAGCAACCTGCTAAATCATCAAAGAGAAAAAAACGTAGGAAAGATGATGAGGTGA
TGATGGATAACGACCAGATAATGATCCCAGGAAATGTATATCAAACATGGCTGAAGGATC
CATCAAGCCTCATTACCAAAAGGCACAGAATCAACAGTAAAGTTAATCTTATTCGGTCAA
TCAAGATAAGAGACCTCATGGACTTGCCCCTCGTTTCTCTAATATCTTCCTTGGAGAAGT
CACCCTTAGAATTTTATTATCCTAAGGAACTTATGCAGCTTTGGAAGGAATGTACTGAAG
TCAAGTCCCCAAAAGCTCCATCTTCAGGAGGGCAGCAGTCATCATCACCAGAACAACAGC
AAAGAAACTTGCCTCCTCAGGCATTTCCAACCCAGCCTCAGGTTGATAATGACAGGGAAA
TGGGATTTCACCCAGTGGACTTTGCAGATGACATCGAAAAACTCCGAGGAAACACTAGTG
GGGAATATGGAAGAGATTATGATGCTTTTCACAGTGATCATAGTGTTACTCCTGGAAGTC
CTGGGCTAAGTCGCAGGTCTGCTTCAAGCTCTGGTGGCTCTGGACGGGGATTTACGCAGT
TGGATCCAGAAGTACAGTTGCCATCCGGAAGGTCCAAGAGGCAGCATTCATCTGGAAAAA
GCTTTGGGAACCTCGATCCAGTTGAAGAAGAATTCCCATTCGAGCAAGAACTTAGAGATT
TCAAGATGAGAAGGCTTTCAGATGTTGGGCCAACTCCAGACCTGCTGGAAGAAATCGAAC
CTACTCAAACCCCATATGAAAAGAAATCCAATCCTATCGACCAGGTCACACAATCAATCC
ACTCGTACCTCAAGCTACACTTTGACACCCCAGGGGCCTCACAGTCTGAATCATTAAGTC
AGCTAGCACATGGGATGACTACAGCAAAGGCTGCCCGACTCTTCTATCAAGCATGCGTTT
TAGCAACTCATGATTTTATCAAGGTTAACCAGCTGGAACCATACGGAGACATCTTGATCT
CGAGGGGACCAAAGATGTGACATCCTAAATGTTTAATAGTTGGACAATTTTCTGCTGTTG
TGGTTCTTGCACATCTCGTGTTATGTATGGTGTTTAAGTTTGCACATGAAGTTTAGAAAA
ACTTCGAAGGAAGGCTTGTAGGTACGTTGTATTGGGGCATGTATTTAACACTAGTTTTGT
GTAGGAAAGAAATTTTGTAAGTATGCTGAATGGCTTGATAGCTGGTGCAAGGTTAAAGTT
A

CDS

1827 bp

>Os05t0580500-02 Rice homolog of yeast REC8, OsRad21-4 protein, Meiotic processes
ATGTTCTACTCGCACCAGCTCCTCGCGCGGAAGGCTCCGCTCGGCCAGATATGGATGGCG
GCGACGCTTCACTCGAAGATCAACCGGAAGCGGCTTGACAAGCTCGACATCATCAAAATC
TGTGAGGAGATTTTGAACCCGTCGGTACCCATGGCACTAAGGCTCTCCGGAATTCTCATG
GGTGGTGTGGCGATCGTGTACGAGAGGAAGGTGAAGGCTCTGTATGATGATGTGTCTCGG
TTTCTGATTGAGATCAACGAGGCATGGCGGGTCAAGCCAGTCGCAGACCCCACCGTACTT
CCCAAGGGCAAAACCCAAGCCAAGTATGAAGCAGTAACACTGCCAGAGAATATCATGGAT
ATGGATGTGGAGCAGCCCATGCTTTTCTCAGAGGCTGATACTACAAGGTTCCGGGGAATG
CGTTTGGAGGATTTGGATGACCAATACATTAATGTCAACCTAGACGATGATGACTTCTCG
CGCGCTGAGAATCATCACCAAGCTGATGCAGAAAATATCACCCTGGCTGATAATTTCGGG
TCTGGGCTTGGAGAGACTGATGTGTTCAATCGTTTTGAGAGATTCGACATAACAGATGAT
GATGCAACTTTCAATGTCACTCCTGATGGACACCCACAGGTTCCAAGTAATCTGGTTCCT
TCTCCACCTAGGCAGGAAGACTCTCCTCAGCAACAAGAAAACCATCATGCTGCCTCATCC
CCTCTTCACGAAGAAGCTCAACAAGGGGGGGCATCTGTAAAAAATGAGCAAGAGCAGCAG
AAGATGAAGGGTCAGCAACCTGCTAAATCATCAAAGAGAAAAAAACGTAGGAAAGATGAT
GAGGTGATGATGGATAACGACCAGATAATGATCCCAGGAAATGTATATCAAACATGGCTG
AAGGATCCATCAAGCCTCATTACCAAAAGGCACAGAATCAACAGTAAAGTTAATCTTATT
CGGTCAATCAAGATAAGAGACCTCATGGACTTGCCCCTCGTTTCTCTAATATCTTCCTTG
GAGAAGTCACCCTTAGAATTTTATTATCCTAAGGAACTTATGCAGCTTTGGAAGGAATGT
ACTGAAGTCAAGTCCCCAAAAGCTCCATCTTCAGGAGGGCAGCAGTCATCATCACCAGAA
CAACAGCAAAGAAACTTGCCTCCTCAGGCATTTCCAACCCAGCCTCAGGTTGATAATGAC
AGGGAAATGGGATTTCACCCAGTGGACTTTGCAGATGACATCGAAAAACTCCGAGGAAAC
ACTAGTGGGGAATATGGAAGAGATTATGATGCTTTTCACAGTGATCATAGTGTTACTCCT
GGAAGTCCTGGGCTAAGTCGCAGGTCTGCTTCAAGCTCTGGTGGCTCTGGACGGGGATTT
ACGCAGTTGGATCCAGAAGTACAGTTGCCATCCGGAAGGTCCAAGAGGCAGCATTCATCT
GGAAAAAGCTTTGGGAACCTCGATCCAGTTGAAGAAGAATTCCCATTCGAGCAAGAACTT
AGAGATTTCAAGATGAGAAGGCTTTCAGATGTTGGGCCAACTCCAGACCTGCTGGAAGAA
ATCGAACCTACTCAAACCCCATATGAAAAGAAATCCAATCCTATCGACCAGGTCACACAA
TCAATCCACTCGTACCTCAAGCTACACTTTGACACCCCAGGGGCCTCACAGTCTGAATCA
TTAAGTCAGCTAGCACATGGGATGACTACAGCAAAGGCTGCCCGACTCTTCTATCAAGCA
TGCGTTTTAGCAACTCATGATTTTATCAAGGTTAACCAGCTGGAACCATACGGAGACATC
TTGATCTCGAGGGGACCAAAGATGTGA

Protein

609 aa

>Os05t0580500-02 Rice homolog of yeast REC8, OsRad21-4 protein, Meiotic processes
MFYSHQLLARKAPLGQIWMAATLHSKINRKRLDKLDIIKICEEILNPSVPMALRLSGILM
GGVAIVYERKVKALYDDVSRFLIEINEAWRVKPVADPTVLPKGKTQAKYEAVTLPENIMD
MDVEQPMLFSEADTTRFRGMRLEDLDDQYINVNLDDDDFSRAENHHQADAENITLADNFG
SGLGETDVFNRFERFDITDDDATFNVTPDGHPQVPSNLVPSPPRQEDSPQQQENHHAASS
PLHEEAQQGGASVKNEQEQQKMKGQQPAKSSKRKKRRKDDEVMMDNDQIMIPGNVYQTWL
KDPSSLITKRHRINSKVNLIRSIKIRDLMDLPLVSLISSLEKSPLEFYYPKELMQLWKEC
TEVKSPKAPSSGGQQSSSPEQQQRNLPPQAFPTQPQVDNDREMGFHPVDFADDIEKLRGN
TSGEYGRDYDAFHSDHSVTPGSPGLSRRSASSSGGSGRGFTQLDPEVQLPSGRSKRQHSS
GKSFGNLDPVEEEFPFEQELRDFKMRRLSDVGPTPDLLEEIEPTQTPYEKKSNPIDQVTQ
SIHSYLKLHFDTPGASQSESLSQLAHGMTTAKAARLFYQACVLATHDFIKVNQLEPYGDI
LISRGPKM*

5'UTR

chr05:28889622..28889674 (+ strand) : 53 bp

CDS

chr05:28889675..28889727 (+ strand) : 53 bp

chr05:28889918..28889986 (+ strand) : 69 bp

chr05:28890085..28890143 (+ strand) : 59 bp

chr05:28890239..28890283 (+ strand) : 45 bp

chr05:28890370..28890389 (+ strand) : 20 bp

chr05:28890498..28890574 (+ strand) : 77 bp

chr05:28891772..28891868 (+ strand) : 97 bp

chr05:28892026..28892107 (+ strand) : 82 bp

chr05:28892187..28892265 (+ strand) : 79 bp

chr05:28892375..28892538 (+ strand) : 164 bp

chr05:28893223..28893266 (+ strand) : 44 bp

chr05:28893347..28893502 (+ strand) : 156 bp

chr05:28893599..28893767 (+ strand) : 169 bp

chr05:28893883..28893950 (+ strand) : 68 bp

chr05:28894062..28894209 (+ strand) : 148 bp

chr05:28894273..28894360 (+ strand) : 88 bp

chr05:28895358..28895485 (+ strand) : 128 bp

chr05:28895585..28895669 (+ strand) : 85 bp

chr05:28895753..28895865 (+ strand) : 113 bp

chr05:28896581..28896663 (+ strand) : 83 bp

3'UTR

chr05:28896664..28896884 (+ strand) : 221 bp

FASTA

>Os05t0580500-02 class=Sequence position=chr05:28889622..28896884 (+ strand)
CAGCGCCTCC ACTCTCACTC GCTCATCCAT TCCCTCCCTC CTCACGATCG AGAATGTTCT ACTCGCACCA GCTCCTCGCG
CGGAAGGCTC CGCTCGGCCA GATATGGTGG GTTTGCTTCG CTCTCCGCTC CTCTCGATCG CGTCCTTTCG GCTTCTCTTC
TCATGCGCCG TTCTGCGGTG CTCCGTTCTA TATTGTTTTC TGCGATTTCT CTGCTCGTTC CGCTCCGAAA TCCGAATGTT
CGCCACTTGG TTGGAGTTGA TTAGGCCGCT GATTACTCCG CTTTTTTTTT TCGCAGGATG GCGGCGACGC TTCACTCGAA
GATCAACCGG AAGCGGCTTG ACAAGCTCGA CATCATCAAA ATCTGGTGAG CGAATTAGTC CGAATCCAGT TGTCTCTGAT
TTCTTCGTTT CGAACTTGAC GGTTTTTTTT GGGGGGATTT TGTGCGTGTG GTTTTTGGGT TAGTGAGGAG ATTTTGAACC
CGTCGGTACC CATGGCACTA AGGCTCTCCG GAATTCTCAT GGGTGAGTCC AGTTTGCTTG TTGTCTCCAT AGTTCCGATC
GCATTTGTTT GGTGATATTT TCTGATGTGG GTGCTTGCGT CGTGGGAGTG TGAGTAGGTG GTGTGGCGAT CGTGTACGAG
AGGAAGGTGA AGGCTCTGTA TGGTGAGTTG CTCCCTGATT GCTTCTCTTT TGTTTCCATT TTTTTTGGAT TCGTTATAGA
CTCAAACTGT GTGAGATCTT CTTCGCAGAT GATGTGTCTC GGTTTCTGGT AAAATTCGAG TTCGATTTTC ACCTAATTTT
GGTGCCTCCT CCTTGATCCA TTTGCCTGTC TATGCTAACA TGGTTCAGAT TACGCTTGTA CTAACTCCTC ACACAGATTG
AGATCAACGA GGCATGGCGG GTCAAGCCAG TCGCAGACCC CACCGTACTT CCCAAGGGCA AAACCCAAGC CAAGTAAGTG
CCCTCTTTGT TTCCATGACC TTCTAGGACT AGAAGTTTCT AGATGTTCTG TGCACGGTTT TGGGTTCGAG GGAAGATTGA
AGAACATGCT ATTATGTTGG TGACCGAGGG GAGTTTGCTT TTGTTTCCCT GCTGCCAGGG ATTGTGAGTT TGTGTGTGAT
TTTCACCATC CGATGCTAAT CTGATGGACT CGTCATTTGA CACAGTTGCA AGTTTTGATA TGTCATCAGC TTACTTGGTT
CTGATTAGAA CATGCTGCAT CTGTGTAATG TTGATTTTAT GATGATACTA TCTCCTTGCA GCATAGTACA TTGTTATGTT
TTCAGATGTA CCTGATGTTG TCATATGACT GATTGTTCTG TTCTACCTGT TGTCTATTGG CGGTTCATGG GACCCTGCTG
TTACTTGCCT CTTGTTGTCT TGCTGACTTT GGTAGCAGCC GATGTCTGTA TTATGCAGGA GTACTATTCT ACAAATGATC
TGTGTTTCCT GGCAGCATAA ATTTGTCTGT ATGTTGTTCC AGTATATGTA GGTCCTCTAC ATTTGTAGGG TGATGAAGGG
CTTTTGCTTC CCCACAGTGT TTCCTCCTCT CTTAATGAAA TGATATACAA CTCTCTTGCA TATTCAAGAA AAAAAAACTG
GAAGGGCATT AGGCAGTTAG GCAGGCATTG TCAGTGAGCG ATACATGCTT TATGGGGATG AACATTTGAC TTTTTCTTGG
GTGTCAGTTA CTGGTGCCAA GGGAGCAGGT CTGAGGGCCG TCTGGTACTT GAGAAATGTT GCTATCTTAG AGTCTAGGGA
ATTCCATCAC CTTTGGGAAC CGGAGGCAAA CATTTCTTAA TCTTGTATCA TGCTCGAAGG ACTGACTCTT GTGGGTGTAC
CATTTCCTTC CATTGTGGCC TGCATCTGAT ATGTAACCAT GTGGCTGTGC CATCATCCCC TTGATCCCTT CGGAACTATG
TTCGATAGTT ACTGCAATGT TCACGTGATG TTGATACCTG TACTGTTGCA ATGAGTTTAA CCCTCTTGGA GTCCTGGATA
GTTCCTCTGA ATGATTGTAT CCCAAGGGTC TTTTCAACTT ACTTTTGTAA ATAGCATAGA GTGGGTATAA GTTGGTGGAT
GGAGAATGAT ATTTTGTACC AAGAGTAAAA CAGTAATGGT TTGCTCATCT AAACTTGGGG CTTCATGCAG GTATGAAGCA
GTAACACTGC CAGAGAATAT CATGGATATG GATGTGGAGC AGCCCATGCT TTTCTCAGAG GCTGATACTA CAAGGTTCCG
GGGAATGGTA ATCCCTGTAA TATGTATATT TCGGTGGTGT CTGATTGTAT GCATTGAAAG ATGGCATTAA GTTATGAGCA
ATAACCACGA GATAGTCTTG CTTTCAGTCT CCTGACTTTT GCCAGATTGT CTCTATTCCT CTGAAATCCG TCATGCATGT
GCAGCGTTTG GAGGATTTGG ATGACCAATA CATTAATGTC AACCTAGACG ATGATGACTT CTCGCGCGCT GAGAATCATC
ACCAAGGTTT TCATTTCTTT TCTTATGAAT TACTCTTTGT GGTTGCTTAA GAGGTGTACT TTCTGACTGA AATATGTTAT
CTCAGCTGAT GCAGAAAATA TCACCCTGGC TGATAATTTC GGGTCTGGGC TTGGAGAGAC TGATGTGTTC AATCGTTTTG
AGAGGTGAAG CAAAATTTTA TTCTTCTCTT ATTCTACCAT TCATTTTTTG CACTTCTTGT TCCTTATTTT GGCCAGTACA
ATTATTCATT GAGCAATGTT ACAATGTCAC CAGATTCGAC ATAACAGATG ATGATGCAAC TTTCAATGTC ACTCCTGATG
GACACCCACA GGTTCCAAGT AATCTGGTTC CTTCTCCACC TAGGCAGGAA GACTCTCCTC AGCAACAAGA AAACCATCAT
GCTGCCTCAT CCCCTCTTCA CGAAGAAGCT CAACAAGGTC AATTCAAGCA CATGGTTTGG TCTATTTGAT CCTAAATTTG
GAAAGGGTAC TATCATCCTG TAAATCGGGA TTTTTTTTCC AGTTTCCATG CCAAAAGACA ACAATTCTCA TCTCTGTTTT
TTAGCATGCC ACAGATGCAA ATGATATTTC AAACAAGTAA AACTTCCATC CAAATATATC TCAGTGAATT TATGATTTGA
TGTAGTTTCT TCAGGGATAT GAACTTGATG GTTATGTCAA TATCTCTTAA CAGCTAGATA TTCTATCTTA TCATATACTC
TGCTATATTA TGTTGGTTAA GAAGCTAAAA GTTCACTCAT CATCTCCTGT TGCCTTTCTA CATTTCCAAC GGTTGGATTT
TCGCGAGGCT AGGTAGAGAT GCTGAGCGAT TGCCATTGAA TTTGCTACAT GTTATGTCAT TGAATTTGGC TTTTGTCAAC
GGGATAATAA AACACATTGT GTAACTTGTC ACCATTCACA CTAGTTTACT GACTGAAATT CAATTTATAT TATATTTGAA
TCTTTTCTAC TTGCTAAACA AGACTTGCAT ATAGCCTCTT CCTCGTGACT ATCTGTACTT CAGTTTGCTA TATCTGATAT
AAGTGCTGGA CATGGTTTGG GTACATTAAT ATGTGCCATA GTGCAAGTGC CTTGTTGCAA TTACTGACAA CTTTTCTGCA
GGGGGGGCAT CTGTAAAAAA TGAGCAAGAG CAGCAGAAGA TGAAGGTTTG TGATCAAGCG AGCCGTTAGC TTCAGGAACA
TCTAGATGAA GAAGATAATT GTTTTGTTTG ATATTGTTTA ACCAGGGTCA GCAACCTGCT AAATCATCAA AGAGAAAAAA
ACGTAGGAAA GATGATGAGG TGATGATGGA TAACGACCAG ATAATGATCC CAGGAAATGT ATATCAAACA TGGCTGAAGG
ATCCATCAAG CCTCATTACC AAAAGGCACA GAATCAACAG TGTATGTAAT TGCTTTGATT ACCTAATTCT GTGTAGAGTT
TTGTAACTAT GCAGAATTTT GTGAACATAT CTGATGTTTT GCCGTGTAAT ATTGCAGAAA GTTAATCTTA TTCGGTCAAT
CAAGATAAGA GACCTCATGG ACTTGCCCCT CGTTTCTCTA ATATCTTCCT TGGAGAAGTC ACCCTTAGAA TTTTATTATC
CTAAGGAACT TATGCAGCTT TGGAAGGAAT GTACTGAAGT CAAGTCCCCA AAAGCTCCAT CTTCAGGTTA CTACACAATT
TGTAGTTTTC TTTCACCTTT CTGGATCACC AAGGGAACTG TAAGTTTTTT ATAATTTAAT CTGCTAAGTT CGAACTGAAA
AGGTTGCAAT CTTTTTTAAA GGAGGGCAGC AGTCATCATC ACCAGAACAA CAGCAAAGAA ACTTGCCTCC TCAGGCATTT
CCAACCCAGG TTATTTCTAA ATTTATATGT TTATGGAAAT GATTTATGCT AGCTTTTCCT ATTGAGCTGT AACATTTACA
TTCATTCTTG AACTTGTCTG ATAAGTGGTT CAATTTGCAG CCTCAGGTTG ATAATGACAG GGAAATGGGA TTTCACCCAG
TGGACTTTGC AGATGACATC GAAAAACTCC GAGGAAACAC TAGTGGGGAA TATGGAAGAG ATTATGATGC TTTTCACAGT
GATCATAGTG TTACTCCTGG AAGTCCTGGT AAGTACAAAA AACAATATAT TTTATTTATT TAGACACTGA ATGACATCAG
TCCTGCTGCA GGGCTAAGTC GCAGGTCTGC TTCAAGCTCT GGTGGCTCTG GACGGGGATT TACGCAGTTG GATCCAGAAG
TACAGTTGCC ATCCGGAAGG TGAGTGTTGA TTAATAGCAA CCTTCACTAG TTTTCTGAAA TATGACTTGT TCCTGGAATA
AATAAAAAGT TATCCGTGCA AACTTTTGAA GATGCATGTC TTTATACTGG AGCCTCTTTG GTTTATGTTC CAAAGCATCG
AAGTGGTTAG TTGTCTTATT GATGAAGTGT TAGGCAAGAA GAAAAGGAAA CGGAGATTGT TACCCCCCCC CTCCAGCGGT
AACCGCTGAA AACCACGTGA AATTCGTCCT CAAATATTTG AATTAAAAAT CGGCGGTTTT GCGTTTTCGG CACAGTAACC
GCGATATTCG CGCGGTTACT GCCAATTGTG TAGCAGAATA GAAACACTCT TAAAAAAGTT TAAAAAAGCA CTTAAATGTG
TGTAGAAATT GGGGATAATT AGAAGAATAT ATAGGATACT TGCAAACCTA ACTTTTGGGT GTAAAATACA AAAATTCTGC
ATGACATTTT CTATGTTATG GACTTCGAAG CAATTCAACA TTTCGTAGCA TAATAATTCA ACAACAACAA TTCAACAACC
TCACATTTGA AAGCATGTGC CGAGAGAGAG CGATagagat agatgagagg acctaggaga tatttttccc acttatggga
cttaatgggc cagataaaca gtgcaactgt gcaacctaag gtccattaca tttttctttt ttccattttc taatgaacat
tcggttttac cctcaaattt gaatttatct tactcttttt caaaaaattt cttcactgtc taccactaca aatcaagaag
tttttttatt tgtttggaat tttgaatttg ggcaaaattt atcaaaccct accaccggta acccttactg tacccccgcg
gtaagcgcgg ttaccgGTGG TAAGGGAAAC CCTGGTCTAG GCTACTTGAC TATCAACTAT CAAGTGGCAG CTTCCTATCT
ATGGTCCTTC TATTTTCATA GAGGTCTTAG TACAACTGCG TGAGGTCATT GAACAGGTCC AAGAGGCAGC ATTCATCTGG
AAAAAGCTTT GGGAACCTCG ATCCAGTTGA AGAAGAATTC CCATTCGAGC AAGAACTTAG AGATTTCAAG ATGAGAAGGC
TTTCAGATGT TGGGCCAACT CCAGGTTGAC TTCTTTTCAG TCCTTATTTC AAATGATTCT ATACAAAAGT GTGGAAATTT
ATTTCCCCGT CATCATACCG ATTAACTTTT AATTTGGTCA CAGACCTGCT GGAAGAAATC GAACCTACTC AAACCCCATA
TGAAAAGAAA TCCAATCCTA TCGACCAGGT CACACAATCA ATCCACTCGT AAGTATTCAA CTATACATTA TGTTTGTTCC
ACAGATTACA GTAGATGTAT ACTCTGTGAT CATCAAACTA AATCCATCCA GGTACCTCAA GCTACACTTT GACACCCCAG
GGGCCTCACA GTCTGAATCA TTAAGTCAGC TAGCACATGG GATGACTACA GCAAAGGCTG CCCGACTCTT CTATCAAGCA
TGCGGTATGA GTTCTATAAT CCCAATGCGA GTCAACAGAT GATGCAATCG CTAGAGTAAA CATAATGTTA ACATTTCATT
TGCTGGTTTG ATGGTTATTT ATAATTTCCG TAAGTTCATT TCAACACTTG ATAAGCCATG TGTACTTCCT TTCCATATTG
CAACTTTGCA ATGAAATATT CCAACCATTG TTTCAAGTTA TGATATCACC GAAACCTTTT AGGCTCATTA CGTTTTTCCC
AGGCTTCTCT CATTACATTG ACCAAGTAAA TATAATAAGT TCACTTTATT AGTTCATGTA GTGTTAAGGG AGGAAAACAA
ATGTGCAATA GCACTATTTC CTGAGTTGGA TAAGTGGGCA ACACCTAGTT TGCTTAGCCA TAGACAGATG TTGGAAAATC
TTGAAGAAGT ACCTTGGAAA TTCAATCGTA CATCATTGTG GCTATGTATT TTTTGTTTCT TTTTCAGATT GTAGCCATGT
TTGATGGACG AGTTAGTGAT TTTAACTATG TCAATAATGG TTATGTTTCT TTTCTCCCTC GATGAGAGAG GATGAGGGCC
TAACACCATG TGTGGGCAAG ATCGGTGTTC ACAAAAGTTT GGTTAGTGTT TTATATTCTT AGCTTTACTG TTTAGCGTGG
CAGTTTGATG TTTTTAGGTG CTTGTATGTG TTATTATTGG TTCAGTACTT GTATTTACTG AGGACCCTTT GTTCTGCAGT
TTTAGCAACT CATGATTTTA TCAAGGTTAA CCAGCTGGAA CCATACGGAG ACATCTTGAT CTCGAGGGGA CCAAAGATGT
GACATCCTAA ATGTTTAATA GTTGGACAAT TTTCTGCTGT TGTGGTTCTT GCACATCTCG TGTTATGTAT GGTGTTTAAG
TTTGCACATG AAGTTTAGAA AAACTTCGAA GGAAGGCTTG TAGGTACGTT GTATTGGGGC ATGTATTTAA CACTAGTTTT
GTGTAGGAAA GAAATTTTGT AAGTATGCTG AATGGCTTGA TAGCTGGTGC AAGGTTAAAG TTA