Os05t0582300-01

Locus

Os05g0582300

Description

Similar to prenyl transferase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSPS2, SPS2

Oryzabase Gene Name Synonym(s)

solanesyl diphosphate synthase 2

Transcript Evidence

AK101790 (DDBJ, Best hit)

AK066579 (DDBJ, Best hit)

Protein Evidence

NP_001149100.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: isoprenoid biosynthetic process (GO:0008299)

Biological Process: photosynthesis (GO:0015979)

Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups (GO:0016765)

Functional domain (InterPro)

Polyprenyl synthetase (IPR000092)

Terpenoid synthase (IPR008949)

Solanesyl diphosphate synthase (IPR014120)

Polyprenyl synthetase-related (IPR017446)

Full-length cDNA

J033065J10 (Online Clone Ordering)

J013071I03 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0582300-01)

Others

Oryzabase (11197)

Transcript

1191 bp

>Os05t0582300-01 Similar to prenyl transferase.
GGAGCCGCCACTTCCTTCCTTCCAAAAAGGAAGAGGGGAAAAAAAATCTATAGCCACCAA
ATTGAGCAAGATTCTCACACGAAACCAATCACAAGCTAGCATTCGTTTAATTTCTTGGCT
GCTATTGTCCGGGGAAGAGGTTCTTGGTGTCCAAAGAATTTGTCGGTTCTAGGGAGCTCC
AAGTTGCTGTAGCTTCATTTCTTGGTTCTTTGGGTTCTTGGATTGGCGGTACTGATTGTG
GGAGATGTTGTCTGTGAGCTGCCCGAGAGTGTACATGAGCAGGAAGGCGCTGGATTTCGG
TCAGCTGGCCTCCTGCCGGTGCCGTTGGGCTGGCCGGTCCGGCATGCGGGTGGCGCCGAG
GCGGCGCATGCCATGTGTTTGTTTCGTGGCCTCACCGAGCCAGCCAGGCCTTGCTGCAGT
TGATGTGCCAGCAGAGGCGATTTCTAGTGCGAGAACAACAACAATGATCCCTGAGCGAAT
TTCTGTTTCTTCACTTTTGGAGGTTGTCTCCGACGACCTGCTGAAACTCAACAATAATCT
GAAATCGCTTGTTGGTGCAGAAAATCCAGTTTTAGTTTCTGCGGCAGAACAAATTTTCGG
TGCTGGTGGAAAAAGGTTAAGACCAGCATTAGTTTTTCTGGTGTCCAGAGCAACTGCTGA
ATTAGCTGGTTTGTTGGAGCTTACTACAGAGCATCAACGCCTGGCAGAGATCATAGAGAT
GATTCACACAGCAAGTTTAATACATGATGATGTCATAGATGATAGTGGCATGAGGAGAGG
GAAAGAAACTATTCATCAGCTATATGGAACACGGGTGGCCGTACTTGCTGGTGATTTTAT
GTTTGCACAATCTTCTTGGTTCCTAGCGAACTTAGAAAACATCGAAGTTATTAAGCTCAT
CAGCCAGGTGATCAAGGACTTTGCCAGTGGTGAGATAAAACAAGCATCTACTCTTTTTGA
CTGCGACGTCACCCTTGATGATTACTTGCTCAAGAGCTATTATAAAACCGCTTCGTTGCT
CGCCTCAAGCACAAGATCTGCTGCAATATTCAGTGGTGTAAGCACCACTATATGCGAACA
AATGTATGAATACGGCAGGAATCTCGGGCTCTCGTTCCAGGTAGTAGATGATATTCTTGA
CTTTACCCAATCAGCTGAGCAACTTGGGAAACCAGCAGGGAGTGACTTAGC

CDS

947 bp

>Os05t0582300-01 Similar to prenyl transferase.
ATGTTGTCTGTGAGCTGCCCGAGAGTGTACATGAGCAGGAAGGCGCTGGATTTCGGTCAG
CTGGCCTCCTGCCGGTGCCGTTGGGCTGGCCGGTCCGGCATGCGGGTGGCGCCGAGGCGG
CGCATGCCATGTGTTTGTTTCGTGGCCTCACCGAGCCAGCCAGGCCTTGCTGCAGTTGAT
GTGCCAGCAGAGGCGATTTCTAGTGCGAGAACAACAACAATGATCCCTGAGCGAATTTCT
GTTTCTTCACTTTTGGAGGTTGTCTCCGACGACCTGCTGAAACTCAACAATAATCTGAAA
TCGCTTGTTGGTGCAGAAAATCCAGTTTTAGTTTCTGCGGCAGAACAAATTTTCGGTGCT
GGTGGAAAAAGGTTAAGACCAGCATTAGTTTTTCTGGTGTCCAGAGCAACTGCTGAATTA
GCTGGTTTGTTGGAGCTTACTACAGAGCATCAACGCCTGGCAGAGATCATAGAGATGATT
CACACAGCAAGTTTAATACATGATGATGTCATAGATGATAGTGGCATGAGGAGAGGGAAA
GAAACTATTCATCAGCTATATGGAACACGGGTGGCCGTACTTGCTGGTGATTTTATGTTT
GCACAATCTTCTTGGTTCCTAGCGAACTTAGAAAACATCGAAGTTATTAAGCTCATCAGC
CAGGTGATCAAGGACTTTGCCAGTGGTGAGATAAAACAAGCATCTACTCTTTTTGACTGC
GACGTCACCCTTGATGATTACTTGCTCAAGAGCTATTATAAAACCGCTTCGTTGCTCGCC
TCAAGCACAAGATCTGCTGCAATATTCAGTGGTGTAAGCACCACTATATGCGAACAAATG
TATGAATACGGCAGGAATCTCGGGCTCTCGTTCCAGGTAGTAGATGATATTCTTGACTTT
ACCCAATCAGCTGAGCAACTTGGGAAACCAGCAGGGAGTGACTTAGC

Protein

315 aa

>Os05t0582300-01 Similar to prenyl transferase.
MLSVSCPRVYMSRKALDFGQLASCRCRWAGRSGMRVAPRRRMPCVCFVASPSQPGLAAVD
VPAEAISSARTTTMIPERISVSSLLEVVSDDLLKLNNNLKSLVGAENPVLVSAAEQIFGA
GGKRLRPALVFLVSRATAELAGLLELTTEHQRLAEIIEMIHTASLIHDDVIDDSGMRRGK
ETIHQLYGTRVAVLAGDFMFAQSSWFLANLENIEVIKLISQVIKDFASGEIKQASTLFDC
DVTLDDYLLKSYYKTASLLASSTRSAAIFSGVSTTICEQMYEYGRNLGLSFQVVDDILDF
TQSAEQLGKPAGSDL

5'UTR

chr05:28984653..28984896 (+ strand) : 244 bp

CDS

chr05:28984897..28985059 (+ strand) : 163 bp

chr05:28985151..28985290 (+ strand) : 140 bp

chr05:28986352..28986479 (+ strand) : 128 bp

chr05:28986567..28986670 (+ strand) : 104 bp

chr05:28986897..28987024 (+ strand) : 128 bp

chr05:28987106..28987389 (+ strand) : 284 bp

FASTA

>Os05t0582300-01 class=Sequence position=chr05:28984653..28987389 (+ strand)
GGAGCCGCCA CTTCCTTCCT TCCAAAAAGG AAGAGGGGAA AAAAAATCTA TAGCCACCAA ATTGAGCAAG ATTCTCACAC
GAAACCAATC ACAAGCTAGC ATTCGTTTAA TTTCTTGGCT GCTATTGTCC GGGGAAGAGG TTCTTGGTGT CCAAAGAATT
TGTCGGTTCT AGGGAGCTCC AAGTTGCTGT AGCTTCATTT CTTGGTTCTT TGGGTTCTTG GATTGGCGGT ACTGATTGTG
GGAGATGTTG TCTGTGAGCT GCCCGAGAGT GTACATGAGC AGGAAGGCGC TGGATTTCGG TCAGCTGGCC TCCTGCCGGT
GCCGTTGGGC TGGCCGGTCC GGCATGCGGG TGGCGCCGAG GCGGCGCATG CCATGTGTTT GTTTCGTGGC CTCACCGAGC
CAGCCAGGTT CTTCATCCTG CAGCTCTTGT TCCTATTGGT CTGTTGAGCC GCTGTGTTTT GGAGTGAGCT GAGCTAACGA
CTTAGCGTAT TTGCGCAGGC CTTGCTGCAG TTGATGTGCC AGCAGAGGCG ATTTCTAGTG CGAGAACAAC AACAATGATC
CCTGAGCGAA TTTCTGTTTC TTCACTTTTG GAGGTTGTCT CCGACGACCT GCTGAAACTC AACAATAATC TGAAATCGGT
GAGCTTCTTC TGAAGGCCAC ATCTTTTGTT TGATTTACTC AGAATTGCGT TAAATAGAGA TGCATTCATG TAGGCTATAC
ATTTCTTACT CAATAGTTTC TCTTTCTGTG AATTCGTCTG ATACATTATC ATGGTTGAAA TGAGTTAAGT CTAGTTTTTT
TTTTTCTTCG AATGCGCAAG AGCCTTGCAT GCCGATATAT TAGCAGAAGA AAAAACTTTT ACAACTGTGA CCCGCTGAGC
GGTCATGGGG AGAGTCAAGT CTACTTAAGA TTTAAGAATC TAATCAGGAA GAAGCTATGA TCAGAGTTAA CTCATTTCGA
TTCTTAAACT GGCAGAACCA GCATCTTGAT AGCTAGTAAA TACTTGGCAC TTGCGCCTTA TATACCAAAG CCGCTCACAG
ACTATAGTTC GATCAGTTCA GTATCATGAG TAACAACTTA AGCTACTATG CTTGGTTCAT TTAGTTGTAA GGAAAATATG
TCAAAACTCT GAAAGGAAAG AAGTAGCATC ATTTTCGATT AGCACATGTA CTTATGAAGT TGACTGCTGA ATGCACGAGA
ATATAGAGAA GTACCGTACA GTTGCCTCCC GTGCATCCCC TAGAAACCAT CCTACAGTCT TTATTTGCTG GCCCCATGTT
TTGATGACTT GGACTTAGCA TCACCAGGAG TACGCGGACA GATTTTTCTG GCTCTTATTT CCTATATCTG TAGGCTCCAT
AATACTTTTG AATGGCTCGC GTGTTGTTGA ATTGCTAGTT TGCTACTAGT CTTCCTACTC CGACCAAAAT ATACATATTT
TTTGTGGTTC TGCACAACAC ACGATTCTCC CTCAAAAACT ACAACAGTTT CTTGTTTGTA CTCCATCCAC AGATCATCAT
TTTTTTGTAT AATTAAGAGA GCATACTTCA GAGCATTACA TATTGAATAC ATATATCTTC ACTAATTTGC TTCATATAGT
GTGTGAGCAC TTGAGTAGAG AAAAATTTGC TAGGCTAGTT CTTTGTGTTT TTCCTACCTA CCAGGCTACC GCAGCAACTA
GCTGACATAA TTTTAATAGC TTGTTGGTGC AGAAAATCCA GTTTTAGTTT CTGCGGCAGA ACAAATTTTC GGTGCTGGTG
GAAAAAGGTT AAGACCAGCA TTAGTTTTTC TGGTGTCCAG AGCAACTGCT GAATTAGCTG GTTTGTTGTA AGTTACTCGT
GTTGCAGCTC TACTACTTAT AATTAGGTGT TTTGCAATTA TGCACTCAAT CCTTTTGTTT TTTTTGCAAT TCAGGGAGCT
TACTACAGAG CATCAACGCC TGGCAGAGAT CATAGAGATG ATTCACACAG CAAGTTTAAT ACATGATGAT GTCATAGATG
ATAGTGGCAT GAGGAGAGGT ACATATCATT CTATTACAAA CAAGTCGCTG TCAATAAATA TCGCTGTTTC TTTCCTTTTC
ATTTTGGTTC ATAGCCTCTT AGAAACAATT TATACATATT CTTTATGCCT GGCAGAATGT GTGGGTTTCT TTTGCTTTTT
GCCTTTTTGG GTGGTTCATG TACTTTGGAC ATTGGTAAGA ACCAATTGAC CAATTTATTC TGAAACGCAT CTGATTATAT
TCAGGGAAAG AAACTATTCA TCAGCTATAT GGAACACGGG TGGCCGTACT TGCTGGTGAT TTTATGTTTG CACAATCTTC
TTGGTTCCTA GCGAACTTAG AAAACATCGA AGTTATTAAG CTCATCAGCC AGGTAATGAA TGAAGAGCAA ACTTCCATCT
CTTCATTAAG ACTGTGCTCC TGCATTGTTT GCTTATAGAT GATGTGTTCA CAGGTGATCA AGGACTTTGC CAGTGGTGAG
ATAAAACAAG CATCTACTCT TTTTGACTGC GACGTCACCC TTGATGATTA CTTGCTCAAG AGCTATTATA AAACCGCTTC
GTTGCTCGCC TCAAGCACAA GATCTGCTGC AATATTCAGT GGTGTAAGCA CCACTATATG CGAACAAATG TATGAATACG
GCAGGAATCT CGGGCTCTCG TTCCAGGTAG TAGATGATAT TCTTGACTTT ACCCAATCAG CTGAGCAACT TGGGAAACCA
GCAGGGAGTG ACTTAGC