Os05t0582300-01

Locus

Os05g0582300

Description

Solanesyl diphosphate synthase, Providing solanesyl diphosphate for plastoquinone-9 (PQ-9) formation

RAP-DB Gene Symbol Synonym(s)

OsSPS2

RAP-DB Gene Name Synonym(s)

solanesyl diphosphate synthase 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSPS2, SPS2

Oryzabase Gene Name Synonym(s)

solanesyl diphosphate synthase 2

Transcript Evidence

AK066579

AK101790 (truncated)

Protein Evidence

Q75HZ9

Literature

PMID: 28751900

PMID: 20421194

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

October 5, 2020

Gene Ontology (GO)

Biological Process: isoprenoid biosynthetic process (GO:0008299)

Functional domain (InterPro)

Isoprenoid synthase domain superfamily (IPR008949)

Polyprenyl synthetase (IPR000092)

Polyprenyl synthetase, conserved site (IPR033749)

Experimentally confirmed subcellular location

plastid (GO:0009536)

Full-length cDNA

J013071I03 (Online Clone Ordering)

J033065J10(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os05t0582300-01)

Others

Oryzabase (11197)

Transcript

1814 bp

>Os05t0582300-01 Solanesyl diphosphate synthase, Providing solanesyl diphosphate for plastoquinone-9 (PQ-9) formation
GAGCCGCCACTTCCTTCCTTCCAAAAAGGAAGAGGGGAAAAAAAATCTATAGCCACCAAA
TTGAGCAAGATTCTCACACGAAACCAATCACAAGCTAGCATTCGTTTAATTTCTTGGCTG
CTATTGTCCGGGGAAGAGGTTCTTGGTGTCCAAAGAATTTGTCGGTTCTAGGGAGCTCCA
AGTTGCTGTAGCTTCATTTCTTGGTTCTTTGGGTTCTTGGATTGGCGGTACTGATTGTGG
GAGATGTTGTCTGTGAGCTGCCCGAGAGTGTACATGAGCAGGAAGGCGCTGGATTTCGGT
CAGCTGGCCTCCTGCCGGTGCCGTTGGGCTGGCCGGTCCGGCATGCGGGTGGCGCCGAGG
CGGCGCATGCCATGTGTTTGTTTCGTGGCCTCACCGAGCCAGCCAGGCCTTGCTGCAGTT
GATGTGCCAGCAGAGGCGATTTCTAGTGCGAGAACAACAACAATGATCCCTGAGCGAATT
TCTGTTTCTTCACTTTTGGAGGTTGTCTCCGACGACCTGCTGAAACTCAACAATAATCTG
AAATCGCTTGTTGGTGCAGAAAATCCAGTTTTAGTTTCTGCGGCAGAACAAATTTTCGGT
GCTGGTGGAAAAAGGTTAAGACCAGCATTAGTTTTTCTGGTGTCCAGAGCAACTGCTGAA
TTAGCTGGTTTGTTGGAGCTTACTACAGAGCATCAACGCCTGGCAGAGATCATAGAGATG
ATTCACACAGCAAGTTTAATACATGATGATGTCATAGATGATAGTGGCATGAGGAGAGGG
AAAGAAACTATTCATCAGCTATATGGAACACGGGTGGCCGTACTTGCTGGTGATTTTATG
TTTGCACAATCTTCTTGGTTCCTAGCGAACTTAGAAAACATCGAAGTTATTAAGCTCATC
AGCCAGGTGATCAAGGACTTTGCCAGTGGTGAGATAAAACAAGCATCTACTCTTTTTGAC
TGCGACGTCACCCTTGATGATTACTTGCTCAAGAGCTATTATAAAACCGCTTCGTTGCTC
GCCTCAAGCACAAGATCTGCTGCAATATTCAGTGGTGTAAGCACCACTATATGCGAACAA
ATGTATGAATACGGCAGGAATCTCGGGCTCTCGTTCCAGGTAGTAGATGATATTCTTGAC
TTTACCCAATCAGCTGAGCAACTTGGGAAACCAGCAGGGAGTGACTTAGCAAAGGGAAAC
CTGACAGCTCCAGTCATATTCGCTTTGCAAGATGAACCCAAACTAAGGGAGATAATCGAT
TCTGAGTTCAGTGAAAGTGATTCATTGGCTACTGCAATCGACTTGGTTCACAGAAGTGGT
GGAATAAGAAGGGCGCAGGAGCTTGCAAAGGAGAAAGGTGACTTGGCTCTCCAAAATTTG
CAGTGCCTTCCCAAGAGCCAGTTCAGAAGTACCCTTGAGAACGTGGTGAAATATAATCTT
CAGAGGATTGACTGATGGATTCACTTGATTCCTCTGAATCACTTGATTTCTCTGAATATA
AGATGCTCGCACCCATGTGGGTTAGTAGCTCCCAAAGAAGTTCATCTTGCTAGAATAATG
TCGATCTTGGGAAGATGATTACAAGCAGCAACTTTTTGTTGTGGATCCACCACCAACATG
TATCATAGCATCCTATTTTGCAGTTTATGTAACTACAAGGCAGATAAAGGAACTAAGGAA
GCATAGTGTATATTTCATAGTAGTTTCAGCTTCTTGATACACGAAATAGTATTTTTTTCC
CCTCCCCTTTCTGCCATTTCATTTGTCATTGGAGAACGACTATGAATTAATTAACATGAT
TATACTTTATAGCC

CDS

1212 bp

>Os05t0582300-01 Solanesyl diphosphate synthase, Providing solanesyl diphosphate for plastoquinone-9 (PQ-9) formation
ATGTTGTCTGTGAGCTGCCCGAGAGTGTACATGAGCAGGAAGGCGCTGGATTTCGGTCAG
CTGGCCTCCTGCCGGTGCCGTTGGGCTGGCCGGTCCGGCATGCGGGTGGCGCCGAGGCGG
CGCATGCCATGTGTTTGTTTCGTGGCCTCACCGAGCCAGCCAGGCCTTGCTGCAGTTGAT
GTGCCAGCAGAGGCGATTTCTAGTGCGAGAACAACAACAATGATCCCTGAGCGAATTTCT
GTTTCTTCACTTTTGGAGGTTGTCTCCGACGACCTGCTGAAACTCAACAATAATCTGAAA
TCGCTTGTTGGTGCAGAAAATCCAGTTTTAGTTTCTGCGGCAGAACAAATTTTCGGTGCT
GGTGGAAAAAGGTTAAGACCAGCATTAGTTTTTCTGGTGTCCAGAGCAACTGCTGAATTA
GCTGGTTTGTTGGAGCTTACTACAGAGCATCAACGCCTGGCAGAGATCATAGAGATGATT
CACACAGCAAGTTTAATACATGATGATGTCATAGATGATAGTGGCATGAGGAGAGGGAAA
GAAACTATTCATCAGCTATATGGAACACGGGTGGCCGTACTTGCTGGTGATTTTATGTTT
GCACAATCTTCTTGGTTCCTAGCGAACTTAGAAAACATCGAAGTTATTAAGCTCATCAGC
CAGGTGATCAAGGACTTTGCCAGTGGTGAGATAAAACAAGCATCTACTCTTTTTGACTGC
GACGTCACCCTTGATGATTACTTGCTCAAGAGCTATTATAAAACCGCTTCGTTGCTCGCC
TCAAGCACAAGATCTGCTGCAATATTCAGTGGTGTAAGCACCACTATATGCGAACAAATG
TATGAATACGGCAGGAATCTCGGGCTCTCGTTCCAGGTAGTAGATGATATTCTTGACTTT
ACCCAATCAGCTGAGCAACTTGGGAAACCAGCAGGGAGTGACTTAGCAAAGGGAAACCTG
ACAGCTCCAGTCATATTCGCTTTGCAAGATGAACCCAAACTAAGGGAGATAATCGATTCT
GAGTTCAGTGAAAGTGATTCATTGGCTACTGCAATCGACTTGGTTCACAGAAGTGGTGGA
ATAAGAAGGGCGCAGGAGCTTGCAAAGGAGAAAGGTGACTTGGCTCTCCAAAATTTGCAG
TGCCTTCCCAAGAGCCAGTTCAGAAGTACCCTTGAGAACGTGGTGAAATATAATCTTCAG
AGGATTGACTGA

Protein

404 aa

>Os05t0582300-01 Solanesyl diphosphate synthase, Providing solanesyl diphosphate for plastoquinone-9 (PQ-9) formation
MLSVSCPRVYMSRKALDFGQLASCRCRWAGRSGMRVAPRRRMPCVCFVASPSQPGLAAVD
VPAEAISSARTTTMIPERISVSSLLEVVSDDLLKLNNNLKSLVGAENPVLVSAAEQIFGA
GGKRLRPALVFLVSRATAELAGLLELTTEHQRLAEIIEMIHTASLIHDDVIDDSGMRRGK
ETIHQLYGTRVAVLAGDFMFAQSSWFLANLENIEVIKLISQVIKDFASGEIKQASTLFDC
DVTLDDYLLKSYYKTASLLASSTRSAAIFSGVSTTICEQMYEYGRNLGLSFQVVDDILDF
TQSAEQLGKPAGSDLAKGNLTAPVIFALQDEPKLREIIDSEFSESDSLATAIDLVHRSGG
IRRAQELAKEKGDLALQNLQCLPKSQFRSTLENVVKYNLQRID*

5'UTR

chr05:28984654..28984896 (+ strand) : 243 bp

CDS

chr05:28984897..28985059 (+ strand) : 163 bp

chr05:28985151..28985290 (+ strand) : 140 bp

chr05:28986352..28986479 (+ strand) : 128 bp

chr05:28986567..28986670 (+ strand) : 104 bp

chr05:28986897..28987024 (+ strand) : 128 bp

chr05:28987106..28987654 (+ strand) : 549 bp

3'UTR

chr05:28987655..28988013 (+ strand) : 359 bp

FASTA

>Os05t0582300-01 class=Sequence position=chr05:28984654..28988013 (+ strand)
GAGCCGCCAC TTCCTTCCTT CCAAAAAGGA AGAGGGGAAA AAAAATCTAT AGCCACCAAA TTGAGCAAGA TTCTCACACG
AAACCAATCA CAAGCTAGCA TTCGTTTAAT TTCTTGGCTG CTATTGTCCG GGGAAGAGGT TCTTGGTGTC CAAAGAATTT
GTCGGTTCTA GGGAGCTCCA AGTTGCTGTA GCTTCATTTC TTGGTTCTTT GGGTTCTTGG ATTGGCGGTA CTGATTGTGG
GAGATGTTGT CTGTGAGCTG CCCGAGAGTG TACATGAGCA GGAAGGCGCT GGATTTCGGT CAGCTGGCCT CCTGCCGGTG
CCGTTGGGCT GGCCGGTCCG GCATGCGGGT GGCGCCGAGG CGGCGCATGC CATGTGTTTG TTTCGTGGCC TCACCGAGCC
AGCCAGGTTC TTCATCCTGC AGCTCTTGTT CCTATTGGTC TGTTGAGCCG CTGTGTTTTG GAGTGAGCTG AGCTAACGAC
TTAGCGTATT TGCGCAGGCC TTGCTGCAGT TGATGTGCCA GCAGAGGCGA TTTCTAGTGC GAGAACAACA ACAATGATCC
CTGAGCGAAT TTCTGTTTCT TCACTTTTGG AGGTTGTCTC CGACGACCTG CTGAAACTCA ACAATAATCT GAAATCGGTG
AGCTTCTTCT GAAGGCCACA TCTTTTGTTT GATTTACTCA GAATTGCGTT AAATAGAGAT GCATTCATGT AGGCTATACA
TTTCTTACTC AATAGTTTCT CTTTCTGTGA ATTCGTCTGA TACATTATCA TGGTTGAAAT GAGTTAAGTC TAGTTTTTTT
TTTTCTTCGA ATGCGCAAGA GCCTTGCATG CCGATATATT AGCAGAAGAA AAAACTTTTA CAACTGTGAC CCGCTGAGCG
GTCATGGGGA GAGTCAAGTC TACTTAAGAT TTAAGAATCT AATCAGGAAG AAGCTATGAT CAGAGTTAAC TCATTTCGAT
TCTTAAACTG GCAGAACCAG CATCTTGATA GCTAGTAAAT ACTTGGCACT TGCGCCTTAT ATACCAAAGC CGCTCACAGA
CTATAGTTCG ATCAGTTCAG TATCATGAGT AACAACTTAA GCTACTATGC TTGGTTCATT TAGTTGTAAG GAAAATATGT
CAAAACTCTG AAAGGAAAGA AGTAGCATCA TTTTCGATTA GCACATGTAC TTATGAAGTT GACTGCTGAA TGCACGAGAA
TATAGAGAAG TACCGTACAG TTGCCTCCCG TGCATCCCCT AGAAACCATC CTACAGTCTT TATTTGCTGG CCCCATGTTT
TGATGACTTG GACTTAGCAT CACCAGGAGT ACGCGGACAG ATTTTTCTGG CTCTTATTTC CTATATCTGT AGGCTCCATA
ATACTTTTGA ATGGCTCGCG TGTTGTTGAA TTGCTAGTTT GCTACTAGTC TTCCTACTCC GACCAAAATA TACATATTTT
TTGTGGTTCT GCACAACACA CGATTCTCCC TCAAAAACTA CAACAGTTTC TTGTTTGTAC TCCATCCACA GATCATCATT
TTTTTGTATA ATTAAGAGAG CATACTTCAG AGCATTACAT ATTGAATACA TATATCTTCA CTAATTTGCT TCATATAGTG
TGTGAGCACT TGAGTAGAGA AAAATTTGCT AGGCTAGTTC TTTGTGTTTT TCCTACCTAC CAGGCTACCG CAGCAACTAG
CTGACATAAT TTTAATAGCT TGTTGGTGCA GAAAATCCAG TTTTAGTTTC TGCGGCAGAA CAAATTTTCG GTGCTGGTGG
AAAAAGGTTA AGACCAGCAT TAGTTTTTCT GGTGTCCAGA GCAACTGCTG AATTAGCTGG TTTGTTGTAA GTTACTCGTG
TTGCAGCTCT ACTACTTATA ATTAGGTGTT TTGCAATTAT GCACTCAATC CTTTTGTTTT TTTTGCAATT CAGGGAGCTT
ACTACAGAGC ATCAACGCCT GGCAGAGATC ATAGAGATGA TTCACACAGC AAGTTTAATA CATGATGATG TCATAGATGA
TAGTGGCATG AGGAGAGGTA CATATCATTC TATTACAAAC AAGTCGCTGT CAATAAATAT CGCTGTTTCT TTCCTTTTCA
TTTTGGTTCA TAGCCTCTTA GAAACAATTT ATACATATTC TTTATGCCTG GCAGAATGTG TGGGTTTCTT TTGCTTTTTG
CCTTTTTGGG TGGTTCATGT ACTTTGGACA TTGGTAAGAA CCAATTGACC AATTTATTCT GAAACGCATC TGATTATATT
CAGGGAAAGA AACTATTCAT CAGCTATATG GAACACGGGT GGCCGTACTT GCTGGTGATT TTATGTTTGC ACAATCTTCT
TGGTTCCTAG CGAACTTAGA AAACATCGAA GTTATTAAGC TCATCAGCCA GGTAATGAAT GAAGAGCAAA CTTCCATCTC
TTCATTAAGA CTGTGCTCCT GCATTGTTTG CTTATAGATG ATGTGTTCAC AGGTGATCAA GGACTTTGCC AGTGGTGAGA
TAAAACAAGC ATCTACTCTT TTTGACTGCG ACGTCACCCT TGATGATTAC TTGCTCAAGA GCTATTATAA AACCGCTTCG
TTGCTCGCCT CAAGCACAAG ATCTGCTGCA ATATTCAGTG GTGTAAGCAC CACTATATGC GAACAAATGT ATGAATACGG
CAGGAATCTC GGGCTCTCGT TCCAGGTAGT AGATGATATT CTTGACTTTA CCCAATCAGC TGAGCAACTT GGGAAACCAG
CAGGGAGTGA CTTAGCAAAG GGAAACCTGA CAGCTCCAGT CATATTCGCT TTGCAAGATG AACCCAAACT AAGGGAGATA
ATCGATTCTG AGTTCAGTGA AAGTGATTCA TTGGCTACTG CAATCGACTT GGTTCACAGA AGTGGTGGAA TAAGAAGGGC
GCAGGAGCTT GCAAAGGAGA AAGGTGACTT GGCTCTCCAA AATTTGCAGT GCCTTCCCAA GAGCCAGTTC AGAAGTACCC
TTGAGAACGT GGTGAAATAT AATCTTCAGA GGATTGACTG ATGGATTCAC TTGATTCCTC TGAATCACTT GATTTCTCTG
AATATAAGAT GCTCGCACCC ATGTGGGTTA GTAGCTCCCA AAGAAGTTCA TCTTGCTAGA ATAATGTCGA TCTTGGGAAG
ATGATTACAA GCAGCAACTT TTTGTTGTGG ATCCACCACC AACATGTATC ATAGCATCCT ATTTTGCAGT TTATGTAACT
ACAAGGCAGA TAAAGGAACT AAGGAAGCAT AGTGTATATT TCATAGTAGT TTCAGCTTCT TGATACACGA AATAGTATTT
TTTTCCCCTC CCCTTTCTGC CATTTCATTT GTCATTGGAG AACGACTATG AATTAATTAA CATGATTATA CTTTATAGCC