Os05t0582800-01

Locus

Os05g0582800

Description

Peptidase S10, serine carboxypeptidase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SCP31

CGSNL Gene Name

SERINE CARBOXYPEPTIDASE 31

Oryzabase Gene Symbol Synonym(s)

OsSCP31

Oryzabase Gene Name Synonym(s)

Serine carboxypeptidase 31

Transcript Evidence

AK069785 (DDBJ, Best hit)

Protein Evidence

NP_172953.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Peptidase S10, serine carboxypeptidase (IPR001563)

Peptidase S10, serine carboxypeptidase, active site (IPR018202)

Full-length cDNA

J023031H02 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0582800-01)

RiceXPro (AK069785)

Others

Oryzabase (19211)

KEGG (Os05t0582800-01 (EC:3.4.16.-))

Transcript

1702 bp

>Os05t0582800-01 Peptidase S10, serine carboxypeptidase family protein.
TTTCAACGCCACAAACCACAGACTGACAAGCTCATCCTGTTCCCATCTCAACTGCGGTCA
CTCACCAATGGCTCCGCCGCTTCTCCTCGTCTCGCTCCTGCTCATCGGCTTCGTCAGCGC
CAGAGCCATCACACCCTCAGCTGAAGCGGCGGCGGTGTTCCCGAAGGAAGCCCTGCCGAC
CAACTCCGGCTACCTCCCCATCACGACAACCAACGCCTCGCTCTTCTTCGCCTACTACGA
GGCCACGCACCCGCTCACGCCGCCGGCCTCCACGCCGCTCCTCCTCTGGCTCCAGGGCGG
CCCCGGCTGCTCCGGCCTCGCCGGCAATTTCTTCGAGCTCGGCCCCTACTTCGTCAACCG
CGACGCGCTCTCCCTCTCGCCCAACCCCTTCTCGTGGAATCGCCGGTTTGGTCTCCTCTT
CATCGACAACCCGCTCGGCACGGGCTTCAGCGCCGCGCCGTCCCCCGCCGCCATCCCCAC
CAACCAGTCCGTCGTCGCCGCGCACCTCTTCGCCGCGCTGCAGTCGTTCTTCGCGCTCCA
GCCGGGCTCCCGCTCCCGCCCCTTCTTCCTCACCGGCGAGAGCTACGCCGGCAAGTATAT
CCCGGCGGCTGGGTCGTACATCCTGGCCGTGAACCCCACGCTGCCGACGCGGCTGCGGGT
TAACCTCCACGGCGTGGCCATCGGCAACGGGCTGACGCACCCCGTCGCGCAGGTGGCGAC
GCACGCGGACACCGCCTACTTCATGGGCCTGATCAACGCCAAGCAGAAGCGGGAGCTGGA
GGCGCTGCAGGcgagggcggtggagctgacgaacgcggcgaggtggagcgaggcggccga
cgcgagggggctcgtgctgtcgtggctggagaacgcgacgggcctggcgacgctgttcga
cgcggcgaagaagcgcccctacgagacgggccccgtggggaagttcgtgaaccgggcgga
ggtgaaggcggcgctgggcgcgcgcggcgacgtggagtgggaggagtgcagcgacgcggt
gggcgcggcgatgcacggggacgtgatgaagagcgtgaagccggaggtggaggcgctgct
gcggggaacgCGCGTGCTGCTGTACCAGGGCATCCGCGACCTCAGGGACGGCGTGGTATC
GACGGAGGCGTGGATGCGGGAGCTGGAGTGGGACGGCCTGCCCGCCTTCCTCGACGCCGA
CCGCGCCGTGTGGCGCATCGGCGAGGAGCTCGCCGGGTACGTGCAGCGCTCCGGCCCGCT
CTCCCACGTCGTCGTCTACGGCGCCGGGCACCTCATGCCGGCGGACAACGGCCGCGCGGC
GCAGGAGATGATCGAGGATTGGGTGTTGCAGGCGGGGCTATTCGGGCGCCACGGCGGGAT
GAAGCGCGCGGCCTGACTCCGCACTCCGGGCGCCGGCGGAGGCCAACCTGTGGCCTCATC
TCTTGCGGTGTCAAACTCTAATCTGATTTTAGAATCGAGCAGAGTACATCGAGGAATACA
AGCATTTGAGTCTATAATTTTTTCTTCTGGTGTGGTTGAATTCATCGTGATAAACTATCC
TGATTTCATTGGGATTATCTCCTCTAGAAGGCAGCTTATTCAGGTTTGTTTTTTGTTCAG
TCCAAGATCAGAGGGCAATACCGAAGGATCACTTTGTACCAAACTACCAATGCAGTATAT
TCAATAACAAGGACTTAGAAGC

CDS

1329 bp

>Os05t0582800-01 Peptidase S10, serine carboxypeptidase family protein.
ATGGCTCCGCCGCTTCTCCTCGTCTCGCTCCTGCTCATCGGCTTCGTCAGCGCCAGAGCC
ATCACACCCTCAGCTGAAGCGGCGGCGGTGTTCCCGAAGGAAGCCCTGCCGACCAACTCC
GGCTACCTCCCCATCACGACAACCAACGCCTCGCTCTTCTTCGCCTACTACGAGGCCACG
CACCCGCTCACGCCGCCGGCCTCCACGCCGCTCCTCCTCTGGCTCCAGGGCGGCCCCGGC
TGCTCCGGCCTCGCCGGCAATTTCTTCGAGCTCGGCCCCTACTTCGTCAACCGCGACGCG
CTCTCCCTCTCGCCCAACCCCTTCTCGTGGAATCGCCGGTTTGGTCTCCTCTTCATCGAC
AACCCGCTCGGCACGGGCTTCAGCGCCGCGCCGTCCCCCGCCGCCATCCCCACCAACCAG
TCCGTCGTCGCCGCGCACCTCTTCGCCGCGCTGCAGTCGTTCTTCGCGCTCCAGCCGGGC
TCCCGCTCCCGCCCCTTCTTCCTCACCGGCGAGAGCTACGCCGGCAAGTATATCCCGGCG
GCTGGGTCGTACATCCTGGCCGTGAACCCCACGCTGCCGACGCGGCTGCGGGTTAACCTC
CACGGCGTGGCCATCGGCAACGGGCTGACGCACCCCGTCGCGCAGGTGGCGACGCACGCG
GACACCGCCTACTTCATGGGCCTGATCAACGCCAAGCAGAAGCGGGAGCTGGAGGCGCTG
CAGGcgagggcggtggagctgacgaacgcggcgaggtggagcgaggcggccgacgcgagg
gggctcgtgctgtcgtggctggagaacgcgacgggcctggcgacgctgttcgacgcggcg
aagaagcgcccctacgagacgggccccgtggggaagttcgtgaaccgggcggaggtgaag
gcggcgctgggcgcgcgcggcgacgtggagtgggaggagtgcagcgacgcggtgggcgcg
gcgatgcacggggacgtgatgaagagcgtgaagccggaggtggaggcgctgctgcgggga
acgCGCGTGCTGCTGTACCAGGGCATCCGCGACCTCAGGGACGGCGTGGTATCGACGGAG
GCGTGGATGCGGGAGCTGGAGTGGGACGGCCTGCCCGCCTTCCTCGACGCCGACCGCGCC
GTGTGGCGCATCGGCGAGGAGCTCGCCGGGTACGTGCAGCGCTCCGGCCCGCTCTCCCAC
GTCGTCGTCTACGGCGCCGGGCACCTCATGCCGGCGGACAACGGCCGCGCGGCGCAGGAG
ATGATCGAGGATTGGGTGTTGCAGGCGGGGCTATTCGGGCGCCACGGCGGGATGAAGCGC
GCGGCCTGA

Protein

443 aa

>Os05t0582800-01 Peptidase S10, serine carboxypeptidase family protein.
MAPPLLLVSLLLIGFVSARAITPSAEAAAVFPKEALPTNSGYLPITTTNASLFFAYYEAT
HPLTPPASTPLLLWLQGGPGCSGLAGNFFELGPYFVNRDALSLSPNPFSWNRRFGLLFID
NPLGTGFSAAPSPAAIPTNQSVVAAHLFAALQSFFALQPGSRSRPFFLTGESYAGKYIPA
AGSYILAVNPTLPTRLRVNLHGVAIGNGLTHPVAQVATHADTAYFMGLINAKQKRELEAL
QARAVELTNAARWSEAADARGLVLSWLENATGLATLFDAAKKRPYETGPVGKFVNRAEVK
AALGARGDVEWEECSDAVGAAMHGDVMKSVKPEVEALLRGTRVLLYQGIRDLRDGVVSTE
AWMRELEWDGLPAFLDADRAVWRIGEELAGYVQRSGPLSHVVVYGAGHLMPADNGRAAQE
MIEDWVLQAGLFGRHGGMKRAA*

5'UTR

chr05:29004127..29004193 (+ strand) : 67 bp

CDS

chr05:29004194..29005522 (+ strand) : 1329 bp

3'UTR

chr05:29005523..29005828 (+ strand) : 306 bp

FASTA

>Os05t0582800-01 class=Sequence position=chr05:29004127..29005828 (+ strand)
TTTCAACGCC ACAAACCACA GACTGACAAG CTCATCCTGT TCCCATCTCA ACTGCGGTCA CTCACCAATG GCTCCGCCGC
TTCTCCTCGT CTCGCTCCTG CTCATCGGCT TCGTCAGCGC CAGAGCCATC ACACCCTCAG CTGAAGCGGC GGCGGTGTTC
CCGAAGGAAG CCCTGCCGAC CAACTCCGGC TACCTCCCCA TCACGACAAC CAACGCCTCG CTCTTCTTCG CCTACTACGA
GGCCACGCAC CCGCTCACGC CGCCGGCCTC CACGCCGCTC CTCCTCTGGC TCCAGGGCGG CCCCGGCTGC TCCGGCCTCG
CCGGCAATTT CTTCGAGCTC GGCCCCTACT TCGTCAACCG CGACGCGCTC TCCCTCTCGC CCAACCCCTT CTCGTGGAAT
CGCCGGTTTG GTCTCCTCTT CATCGACAAC CCGCTCGGCA CGGGCTTCAG CGCCGCGCCG TCCCCCGCCG CCATCCCCAC
CAACCAGTCC GTCGTCGCCG CGCACCTCTT CGCCGCGCTG CAGTCGTTCT TCGCGCTCCA GCCGGGCTCC CGCTCCCGCC
CCTTCTTCCT CACCGGCGAG AGCTACGCCG GCAAGTATAT CCCGGCGGCT GGGTCGTACA TCCTGGCCGT GAACCCCACG
CTGCCGACGC GGCTGCGGGT TAACCTCCAC GGCGTGGCCA TCGGCAACGG GCTGACGCAC CCCGTCGCGC AGGTGGCGAC
GCACGCGGAC ACCGCCTACT TCATGGGCCT GATCAACGCC AAGCAGAAGC GGGAGCTGGA GGCGCTGCAG Gcgagggcgg
tggagctgac gaacgcggcg aggtggagcg aggcggccga cgcgaggggg ctcgtgctgt cgtggctgga gaacgcgacg
ggcctggcga cgctgttcga cgcggcgaag aagcgcccct acgagacggg ccccgtgggg aagttcgtga accgggcgga
ggtgaaggcg gcgctgggcg cgcgcggcga cgtggagtgg gaggagtgca gcgacgcggt gggcgcggcg atgcacgggg
acgtgatgaa gagcgtgaag ccggaggtgg aggcgctgct gcggggaacg CGCGTGCTGC TGTACCAGGG CATCCGCGAC
CTCAGGGACG GCGTGGTATC GACGGAGGCG TGGATGCGGG AGCTGGAGTG GGACGGCCTG CCCGCCTTCC TCGACGCCGA
CCGCGCCGTG TGGCGCATCG GCGAGGAGCT CGCCGGGTAC GTGCAGCGCT CCGGCCCGCT CTCCCACGTC GTCGTCTACG
GCGCCGGGCA CCTCATGCCG GCGGACAACG GCCGCGCGGC GCAGGAGATG ATCGAGGATT GGGTGTTGCA GGCGGGGCTA
TTCGGGCGCC ACGGCGGGAT GAAGCGCGCG GCCTGACTCC GCACTCCGGG CGCCGGCGGA GGCCAACCTG TGGCCTCATC
TCTTGCGGTG TCAAACTCTA ATCTGATTTT AGAATCGAGC AGAGTACATC GAGGAATACA AGCATTTGAG TCTATAATTT
TTTCTTCTGG TGTGGTTGAA TTCATCGTGA TAAACTATCC TGATTTCATT GGGATTATCT CCTCTAGAAG GCAGCTTATT
CAGGTTTGTT TTTTGTTCAG TCCAAGATCA GAGGGCAATA CCGAAGGATC ACTTTGTACC AAACTACCAA TGCAGTATAT
TCAATAACAA GGACTTAGAA GC