Os05t0582800-02

Locus

Os05g0582800

Description

Peptidase S10, serine carboxypeptidase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SCP31

CGSNL Gene Name

SERINE CARBOXYPEPTIDASE 31

Oryzabase Gene Symbol Synonym(s)

OsSCP31

Oryzabase Gene Name Synonym(s)

Serine carboxypeptidase 31

Transcript Evidence

AK105906 (DDBJ, Best hit)

Protein Evidence

NP_172953.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Peptidase S10, serine carboxypeptidase (IPR001563)

Peptidase S10, serine carboxypeptidase, active site (IPR018202)

Full-length cDNA

001-204-G02 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0582800-02)

RiceXPro (AK105906)

Others

Oryzabase (19211)

KEGG (Os05t0582800-02 (EC:3.4.16.-))

Transcript

1482 bp

>Os05t0582800-02 Peptidase S10, serine carboxypeptidase family protein.
ATCCTGTTCCCATCTCAACTGCGGTCACTCACCAATGGCTCCGCCGCTTCTCCTCGTCTC
GCTCCTGCTCATCGGCTTCGTCAGCGCCAGAGCCATCACACCCTCAGCTGAAGCGGCGGC
GGTGTTCCCGAAGGAAGCCCTGCCGACCAACTCCGGCTACCTCCCCATCACGACAACCAA
CGCCTCGCTCTTCTTCGCCTACTACGAGGCCACGCACCCGCTCACGCCGCCGGCCTCCAC
GCCGCTCCTCCTCTGGCTCCAGGGCGGCCCCGGCTGCTCCGGCCTCGCCGGCAATTTCTT
CGAGCTCGGCCCCTACTTCGTCAACCGCGACGCGCTCTCCCTCTCGCCCAACCCCTTCTC
GTGGAATCGCCGGTTTGGTCTCCTCTTCATCGACAACCCGCTCGGCACGGGCTTCAGCGC
CGCGCCGTCCCCCGCCGCCATCCCCACCAACCAGTCCGTCGTCGCCGCGCACCTCTTCGC
CGCGCTGCAGTCGTTCTTCGCGCTCCAGCCGGGCTCCCGCTCCCGCCCCTTCTTCCTCAC
CGGCGAGAGCTACGCCGGCAAGTATATCCCGGCGGCTGGGTCGTACATCCTGGCCGTGAA
CCCCACGCTGCCGACGCGGCTGCGGGTTAACCTCCACGGCGTGGCCATCGGCAACGGGCT
GACGCACCCCGTCGCGCAGGTGGCGACGCACGCGGACACCGCCTACTTCATGGGCCTGAT
CAACGCCAAGCAGAAGCGGGAGCTGGAGGCGCTGCAGGcgagggcggtggagctgacgaa
cgcggcgaggtggagcgaggcggccgacgcgagggggctcgtgctgtcgtggctggagaa
cgcgacgggcctggcgacgctgttcgacgcggcgaagaagcgcccctacgagacgggccc
cgtggggaagttcgtgaaccgggcggaggtgaaggcggcgctgggcgcgcgcggcgacgt
ggagtgggaggagtgcagcgacgcggtgggcgcggcgatgcacggggacgtgatgaagag
cgtgaagccggaggtggaggcgctgctgcggggaacgCGCGTGCTGCTGTACCAGGGCAT
CCGCGACCTCAGGGACGGCGTGGTATCGACGGAGGCGTGGATGCGGGAGCTGGAGTGGGA
CGGCCTGCCCGCCTTCCTCGACGCCGACCGCGCCGTGTGGCGCATCGGCGAGGAGCTCGC
CGGGTACGTGCAGCGCTCCGGCCCGCTCTCCCACGTCGTCGTCTACGGCGCCGGGCACCT
CATGCCGGCGGACAACGGCCGCGCGGCGCAGGAGATGATCGAGGATTGGGTGTTGCAGGC
GGGGCTATTCGGGCGCCACGGCGGGATGAAGCGCGCGGCCTGACTCCGCACTCCGGGCGC
CGGCGGAGGCCAACCTGTGGCCTCATCTCTTGCGGTGTCAAACTCTAATCTGATTTTAGA
ATCGAGCAGAGTACATCGAGGAATACAAGCATTTGAGTCTAT

CDS

1329 bp

>Os05t0582800-02 Peptidase S10, serine carboxypeptidase family protein.
ATGGCTCCGCCGCTTCTCCTCGTCTCGCTCCTGCTCATCGGCTTCGTCAGCGCCAGAGCC
ATCACACCCTCAGCTGAAGCGGCGGCGGTGTTCCCGAAGGAAGCCCTGCCGACCAACTCC
GGCTACCTCCCCATCACGACAACCAACGCCTCGCTCTTCTTCGCCTACTACGAGGCCACG
CACCCGCTCACGCCGCCGGCCTCCACGCCGCTCCTCCTCTGGCTCCAGGGCGGCCCCGGC
TGCTCCGGCCTCGCCGGCAATTTCTTCGAGCTCGGCCCCTACTTCGTCAACCGCGACGCG
CTCTCCCTCTCGCCCAACCCCTTCTCGTGGAATCGCCGGTTTGGTCTCCTCTTCATCGAC
AACCCGCTCGGCACGGGCTTCAGCGCCGCGCCGTCCCCCGCCGCCATCCCCACCAACCAG
TCCGTCGTCGCCGCGCACCTCTTCGCCGCGCTGCAGTCGTTCTTCGCGCTCCAGCCGGGC
TCCCGCTCCCGCCCCTTCTTCCTCACCGGCGAGAGCTACGCCGGCAAGTATATCCCGGCG
GCTGGGTCGTACATCCTGGCCGTGAACCCCACGCTGCCGACGCGGCTGCGGGTTAACCTC
CACGGCGTGGCCATCGGCAACGGGCTGACGCACCCCGTCGCGCAGGTGGCGACGCACGCG
GACACCGCCTACTTCATGGGCCTGATCAACGCCAAGCAGAAGCGGGAGCTGGAGGCGCTG
CAGGcgagggcggtggagctgacgaacgcggcgaggtggagcgaggcggccgacgcgagg
gggctcgtgctgtcgtggctggagaacgcgacgggcctggcgacgctgttcgacgcggcg
aagaagcgcccctacgagacgggccccgtggggaagttcgtgaaccgggcggaggtgaag
gcggcgctgggcgcgcgcggcgacgtggagtgggaggagtgcagcgacgcggtgggcgcg
gcgatgcacggggacgtgatgaagagcgtgaagccggaggtggaggcgctgctgcgggga
acgCGCGTGCTGCTGTACCAGGGCATCCGCGACCTCAGGGACGGCGTGGTATCGACGGAG
GCGTGGATGCGGGAGCTGGAGTGGGACGGCCTGCCCGCCTTCCTCGACGCCGACCGCGCC
GTGTGGCGCATCGGCGAGGAGCTCGCCGGGTACGTGCAGCGCTCCGGCCCGCTCTCCCAC
GTCGTCGTCTACGGCGCCGGGCACCTCATGCCGGCGGACAACGGCCGCGCGGCGCAGGAG
ATGATCGAGGATTGGGTGTTGCAGGCGGGGCTATTCGGGCGCCACGGCGGGATGAAGCGC
GCGGCCTGA

Protein

443 aa

>Os05t0582800-02 Peptidase S10, serine carboxypeptidase family protein.
MAPPLLLVSLLLIGFVSARAITPSAEAAAVFPKEALPTNSGYLPITTTNASLFFAYYEAT
HPLTPPASTPLLLWLQGGPGCSGLAGNFFELGPYFVNRDALSLSPNPFSWNRRFGLLFID
NPLGTGFSAAPSPAAIPTNQSVVAAHLFAALQSFFALQPGSRSRPFFLTGESYAGKYIPA
AGSYILAVNPTLPTRLRVNLHGVAIGNGLTHPVAQVATHADTAYFMGLINAKQKRELEAL
QARAVELTNAARWSEAADARGLVLSWLENATGLATLFDAAKKRPYETGPVGKFVNRAEVK
AALGARGDVEWEECSDAVGAAMHGDVMKSVKPEVEALLRGTRVLLYQGIRDLRDGVVSTE
AWMRELEWDGLPAFLDADRAVWRIGEELAGYVQRSGPLSHVVVYGAGHLMPADNGRAAQE
MIEDWVLQAGLFGRHGGMKRAA*

5'UTR

chr05:29004160..29004193 (+ strand) : 34 bp

CDS

chr05:29004194..29005522 (+ strand) : 1329 bp

3'UTR

chr05:29005523..29005641 (+ strand) : 119 bp

FASTA

>Os05t0582800-02 class=Sequence position=chr05:29004160..29005641 (+ strand)
ATCCTGTTCC CATCTCAACT GCGGTCACTC ACCAATGGCT CCGCCGCTTC TCCTCGTCTC GCTCCTGCTC ATCGGCTTCG
TCAGCGCCAG AGCCATCACA CCCTCAGCTG AAGCGGCGGC GGTGTTCCCG AAGGAAGCCC TGCCGACCAA CTCCGGCTAC
CTCCCCATCA CGACAACCAA CGCCTCGCTC TTCTTCGCCT ACTACGAGGC CACGCACCCG CTCACGCCGC CGGCCTCCAC
GCCGCTCCTC CTCTGGCTCC AGGGCGGCCC CGGCTGCTCC GGCCTCGCCG GCAATTTCTT CGAGCTCGGC CCCTACTTCG
TCAACCGCGA CGCGCTCTCC CTCTCGCCCA ACCCCTTCTC GTGGAATCGC CGGTTTGGTC TCCTCTTCAT CGACAACCCG
CTCGGCACGG GCTTCAGCGC CGCGCCGTCC CCCGCCGCCA TCCCCACCAA CCAGTCCGTC GTCGCCGCGC ACCTCTTCGC
CGCGCTGCAG TCGTTCTTCG CGCTCCAGCC GGGCTCCCGC TCCCGCCCCT TCTTCCTCAC CGGCGAGAGC TACGCCGGCA
AGTATATCCC GGCGGCTGGG TCGTACATCC TGGCCGTGAA CCCCACGCTG CCGACGCGGC TGCGGGTTAA CCTCCACGGC
GTGGCCATCG GCAACGGGCT GACGCACCCC GTCGCGCAGG TGGCGACGCA CGCGGACACC GCCTACTTCA TGGGCCTGAT
CAACGCCAAG CAGAAGCGGG AGCTGGAGGC GCTGCAGGcg agggcggtgg agctgacgaa cgcggcgagg tggagcgagg
cggccgacgc gagggggctc gtgctgtcgt ggctggagaa cgcgacgggc ctggcgacgc tgttcgacgc ggcgaagaag
cgcccctacg agacgggccc cgtggggaag ttcgtgaacc gggcggaggt gaaggcggcg ctgggcgcgc gcggcgacgt
ggagtgggag gagtgcagcg acgcggtggg cgcggcgatg cacggggacg tgatgaagag cgtgaagccg gaggtggagg
cgctgctgcg gggaacgCGC GTGCTGCTGT ACCAGGGCAT CCGCGACCTC AGGGACGGCG TGGTATCGAC GGAGGCGTGG
ATGCGGGAGC TGGAGTGGGA CGGCCTGCCC GCCTTCCTCG ACGCCGACCG CGCCGTGTGG CGCATCGGCG AGGAGCTCGC
CGGGTACGTG CAGCGCTCCG GCCCGCTCTC CCACGTCGTC GTCTACGGCG CCGGGCACCT CATGCCGGCG GACAACGGCC
GCGCGGCGCA GGAGATGATC GAGGATTGGG TGTTGCAGGC GGGGCTATTC GGGCGCCACG GCGGGATGAA GCGCGCGGCC
TGACTCCGCA CTCCGGGCGC CGGCGGAGGC CAACCTGTGG CCTCATCTCT TGCGGTGTCA AACTCTAATC TGATTTTAGA
ATCGAGCAGA GTACATCGAG GAATACAAGC ATTTGAGTCT AT