Os05t0587200-01

Locus

Os05g0587200

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET23

Oryzabase Gene Name Synonym(s)

SET protein 23

Transcript Evidence

AK066321 (DDBJ, Best hit)

Protein Evidence

B9FLU9 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J013060L04 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0587200-01)

RiceXPro (AK066321)

Others

Oryzabase (13388)

KEGG (Os05t0587200-01)

Transcript

3161 bp

>Os05t0587200-01 Conserved hypothetical protein.
GATAACGTATTCTTCCATCGCAGGAGGTGCGCTTCCTATCCCCATCGCCACCCATGGCGA
CTCCCGCCGCTTCCCCTCTCCTGCTGCCGCTCCCCCTCCCCCTCCCGGCCTCCACCTTCC
CGCCTCGCCGCGCCGTTCCCTGCGCCCGCCGCCTCGTCTTGCGGCCTCCCCGCGCCGGAC
GCCCTCGCCTCCGGGACCCGCCTCCCGCGGCACCCCCACCGGCGGCGGAGGAGGTCGGCG
AGGAGGAAGAGGACGACGATGCCCCCCCGCTCAGGCTCCTCGAACCGCCCCAGGAGGACG
ACCCCTTCCCGCCCGAGATGGAGCCGGCCGACCCCGACTTCTACCGGATAGGGTACGCGC
GGATGATGCGGGCGTACGGGGTTGAGTTCTTGGAAGGCCCCGATGGGATGGCCGTCTATG
CCTCCCGGGACGTCGACCCACTCCGCAGAGCTAGAGTGATTATGGAGATTCCATTGGAGC
TGATGCTGACTATAACTCAAAAACGCCCTTGGATGTTTTTCCCCGACATTATTCCACTAG
GCCATCCCATATTTGACATCATTGAATCAACAGATCCTGAGGTAAATGGAGCCCTCTAAC
CCTCTAATTATGGTATGTTCCAGTGAAGACTGTATGTGCATTCCAGAGTTTGTGTTTTTT
AGTTTCTACAGAATCACTTATGAGGAACATTGTGTAATTAAGATTCAATAGCGCTTTGAC
TGCCCATTCCATCTACTATGAAAATAAGCTGTTATATTGGATAAAAGGGATGGTATTACT
CAACACTTGCAACCTGTTTTCTTCCTTCATGCGGTGTCAAAGCTTCATAAGTGATGTAGA
CTGCATCCTAACGCAATCTGTACCCTCTTGCAGACAGATTGGGATCTAAGGTTAGCTTGC
CTTCTTCTCTATGCATTTGATGTAGAAGACAACTTTTGGCAGCTATATGGTGATTTTTTG
CCTAGTGTTGATGAATGCACTAGCTTGCTTTTGGCACCAAAGGTATTGTAAATCTAAACA
AAATGAATTGTAGTCTTCTTAAACCTGACAATACAGTTTGAATGAATTTACATGCCTGGC
TTGCCAGGACGATCTAATGGAACTAGAAGACCAAGATCTTGCCACGAAAATGTTAAAGAA
CCAGAAGAGAGCAATTGATTTTTGGCAAAAACATTGGGTACACTTCTGTACTATTTGATC
AACTTCGCTGGCTTGGGTACATCTAACACTAGCTTGATGGGTAATGTCCAGCATAAAACA
ATCCCTCTAAAGCTAAAGCGTCTTGCCCCTGACCATGAAAGATTTCTATGGGCACTGAGT
ATTGTTCAGTCTCGCTCTGTCAATTTGAAACTGAGAATGGGAGCCTTCCTCCAAGATGCA
AATGTCCTAGTGCCGTATGCTGGTACATGTTTTCTTATCTGTTCCCCTTTATGCTCTTTA
TTTTTATTTTCAGTGTGTATTAAGCACCGATTACTAAAATTAAGAATAAAATCACTTAGT
TTCTTCAGCTTGCGATGATAATCAGATGTCTAACAGTCTAAGTCAAGGCTGCGGTCTGAG
GGATCTTTTGCTCCATTTATTTTGAGCTGGCGAATGCTATAAAGGTTTTTATAATGTTAT
AGCGCTAATGTTACTTGCACAGTAAATCATAGTTACCAACTGATCCAAGATATTATATTT
TCTAATATCAGCACTACTTCTGTATGGTTAAACTCTGTTGGAATAAGGATCTAACTAATA
TCTATTGTCATTTTTCACACCAATACTACGCTTTATTCCTTCTAGACGTTCTAGTCAGGC
AGTATAGTTACATTGAATTACTTAATAATTATCACAAAGGCATGAAATTCAAAACTATAC
TGTTCTGATAATCAGCATATTCTAGCTTCTGATTACTGATACTGAGTCTCATCATAACTT
ATAGCTTGCCTATTTGTCTCCAGATATGCTGAATCATTCACCTGATGCTAATTGTTTCCT
GCATTGGCGTTTCAAAGATCGTATGGTTGAAGTCATGATTAAGGCTGGGCATGCTGTCAA
AAAAGGAGATGAGATGACAATTGATTATATGAGTGGAGTGAACAGCTCATTTATGGAAAG
ATATGGTTTCTCATCACCAACGGTATGATCATGTGTTTGATTTTAATTCTTGCTTGTTCT
TGCAAGCCACATCTGTCCTTTCCCACTTGGCAGGACTTAGCATTGAGGAATATTGTGTTG
GGTATAAGTATAACTATATCTGCGAGATTATGGTTCTGCTTAAAGGAAACAACTCTAGCA
TCAAATATGTTGTGCTGCTATGCTAGATTGCTAGGCATGTTAATACGATACCATGCATTG
AAACAACTACAGTGTCATTTTTTTTTTTAAAAAAAATGTGACTTCTTATATGGTTGTGTG
CACACAACAAACACTACAGAATCCTTGGGAGCTTATAAACTTCTCGAGTGATGCCAAGAT
TCATCTTGACTCCTTCCTGTCGGTCTTCAACATTGCTGGCTTGCATGATGAGCTCTACCA
CAATGCTGCATTGACCTCAGGAGAAAACAACTTTGTTGATGGAGGAGTCGTGGCAGCAGC
AAGAACTCTGCCGACATGGTCAGAAGGTGATGTTCCTGCCATACCAAGCTTGGAAAGAAA
ATCTGCTCAGGCATTACAAGAGGAATGCCATACGATGCTGGAGTCCTTTTCAACCACTAT
TCAACAAGACCAGGAGATTCTAGATTCTGATGGACATATCAGAAGAACACGTGAAATCGC
AATCAAATATCGGCTACACCGGAAGCTGCTCCTGCAGAAAATCATCGATGCATTGGATAT
CTACCAGGATAAAATTTTGTTTTAGATAGCTGTATAGGCAACAACTAGTTGAGCTCCAGT
GCTAGTTTGCTAAGCGCTGGAGTGTCTTTAGATGATTTTGTGAAGGGGGTTTCACTCACA
TCTGTAACAGTAGGGATTTCACCTCATTCTTTTAGATATTTCCACTTTGGTAGATAGCAG
TATAGTGAAATAAAGACAGTGCCCATGAGGTAGTGTAGTTTCCAGCCAGTGACCTGCAGA
AAATCAAGtaatccctctgtttcgaactacttgtgttctagttttgtcctaaggtaaaca
ttttaatatttgactatcaatttctataaactcatataGTC

CDS

546 bp

>Os05t0587200-01 Conserved hypothetical protein.
ATGGCGACTCCCGCCGCTTCCCCTCTCCTGCTGCCGCTCCCCCTCCCCCTCCCGGCCTCC
ACCTTCCCGCCTCGCCGCGCCGTTCCCTGCGCCCGCCGCCTCGTCTTGCGGCCTCCCCGC
GCCGGACGCCCTCGCCTCCGGGACCCGCCTCCCGCGGCACCCCCACCGGCGGCGGAGGAG
GTCGGCGAGGAGGAAGAGGACGACGATGCCCCCCCGCTCAGGCTCCTCGAACCGCCCCAG
GAGGACGACCCCTTCCCGCCCGAGATGGAGCCGGCCGACCCCGACTTCTACCGGATAGGG
TACGCGCGGATGATGCGGGCGTACGGGGTTGAGTTCTTGGAAGGCCCCGATGGGATGGCC
GTCTATGCCTCCCGGGACGTCGACCCACTCCGCAGAGCTAGAGTGATTATGGAGATTCCA
TTGGAGCTGATGCTGACTATAACTCAAAAACGCCCTTGGATGTTTTTCCCCGACATTATT
CCACTAGGCCATCCCATATTTGACATCATTGAATCAACAGATCCTGAGGTAAATGGAGCC
CTCTAA

Protein

182 aa

>Os05t0587200-01 Conserved hypothetical protein.
MATPAASPLLLPLPLPLPASTFPPRRAVPCARRLVLRPPRAGRPRLRDPPPAAPPPAAEE
VGEEEEDDDAPPLRLLEPPQEDDPFPPEMEPADPDFYRIGYARMMRAYGVEFLEGPDGMA
VYASRDVDPLRRARVIMEIPLELMLTITQKRPWMFFPDIIPLGHPIFDIIESTDPEVNGA
L*

5'UTR

chr05:29251590..29251642 (+ strand) : 53 bp

CDS

chr05:29251643..29251906 (+ strand) : 264 bp

chr05:29252000..29252137 (+ strand) : 138 bp

chr05:29252690..29252833 (+ strand) : 144 bp

3'UTR

chr05:29252834..29254287 (+ strand) : 1454 bp

chr05:29254461..29254932 (+ strand) : 472 bp

chr05:29255022..29255219 (+ strand) : 198 bp

chr05:29255313..29255355 (+ strand) : 43 bp

chr05:29255454..29255848 (+ strand) : 395 bp

FASTA

>Os05t0587200-01 class=Sequence position=chr05:29251590..29255848 (+ strand)
GATAACGTAT TCTTCCATCG CAGGAGGTGC GCTTCCTATC CCCATCGCCA CCCATGGCGA CTCCCGCCGC TTCCCCTCTC
CTGCTGCCGC TCCCCCTCCC CCTCCCGGCC TCCACCTTCC CGCCTCGCCG CGCCGTTCCC TGCGCCCGCC GCCTCGTCTT
GCGGCCTCCC CGCGCCGGAC GCCCTCGCCT CCGGGACCCG CCTCCCGCGG CACCCCCACC GGCGGCGGAG GAGGTCGGCG
AGGAGGAAGA GGACGACGAT GCCCCCCCGC TCAGGCTCCT CGAACCGCCC CAGGAGGACG ACCCCTTCCC GCCCGAGGTG
CTCAATCTCT TCCCGCCTAG TTGCTTCCGT TGCTCACATC TCTTCTGCTC GCGCGCATGC ATGCATGATG AACAATGTCG
TCGTGTGCAG ATGGAGCCGG CCGACCCCGA CTTCTACCGG ATAGGGTACG CGCGGATGAT GCGGGCGTAC GGGGTTGAGT
TCTTGGAAGG CCCCGATGGG ATGGCCGTCT ATGCCTCCCG GGACGTCGAC CCACTCCGCA GAGCTAGAGT GAGCCTTTCT
TTAACTATCC CATCATTATC TTTCCAATTC ACTGCAATTG GACATAAGTA CTATACTTAC AAAGGGGCAT TACAAATAGC
ATGTACAAGT ACAATGTAGA GCCAGCCACA GCCAGTACTC ACTCCACTCC AGTACATATA TATGGTCTAC ATTCTGTGGT
TGTTACTTTA CCATTTACTG CTAGTTGGTT AGCGTATGTA TGTCCTACTA TCAGAACAAA TATGAATTCT ACTGAATAGT
ACGAAATGAA GTCAATCTTT GAATTTGTTA GGTACTTTAC GCTTACATAT CTTCTGCTGC CTTTTATAAT GCTATGCAAA
TAATCAAATA TGGTGTAAGG ACTGCTCACA TTCAGTTTCT GGATGCAACT AAAGCTTGCT AGTGCTTCAC TTTAATATAC
CACATAGAAC TGTTCTATTT CAGAAATCAT GAGGCAGCTT GCTCGTGTGT TCACTACTTT TTAAGAACTA GTTAAGTTTA
ATCACACACT TATGCATAAT CTTCTTGGCA TATATATAAA AATTCATTTC ACTTTATCAG GTGATTATGG AGATTCCATT
GGAGCTGATG CTGACTATAA CTCAAAAACG CCCTTGGATG TTTTTCCCCG ACATTATTCC ACTAGGCCAT CCCATATTTG
ACATCATTGA ATCAACAGAT CCTGAGGTAA ATGGAGCCCT CTAACCCTCT AATTATGGTA TGTTCCAGTG AAGACTGTAT
GTGCATTCCA GAGTTTGTGT TTTTTAGTTT CTACAGAATC ACTTATGAGG AACATTGTGT AATTAAGATT CAATAGCGCT
TTGACTGCCC ATTCCATCTA CTATGAAAAT AAGCTGTTAT ATTGGATAAA AGGGATGGTA TTACTCAACA CTTGCAACCT
GTTTTCTTCC TTCATGCGGT GTCAAAGCTT CATAAGTGAT GTAGACTGCA TCCTAACGCA ATCTGTACCC TCTTGCAGAC
AGATTGGGAT CTAAGGTTAG CTTGCCTTCT TCTCTATGCA TTTGATGTAG AAGACAACTT TTGGCAGCTA TATGGTGATT
TTTTGCCTAG TGTTGATGAA TGCACTAGCT TGCTTTTGGC ACCAAAGGTA TTGTAAATCT AAACAAAATG AATTGTAGTC
TTCTTAAACC TGACAATACA GTTTGAATGA ATTTACATGC CTGGCTTGCC AGGACGATCT AATGGAACTA GAAGACCAAG
ATCTTGCCAC GAAAATGTTA AAGAACCAGA AGAGAGCAAT TGATTTTTGG CAAAAACATT GGGTACACTT CTGTACTATT
TGATCAACTT CGCTGGCTTG GGTACATCTA ACACTAGCTT GATGGGTAAT GTCCAGCATA AAACAATCCC TCTAAAGCTA
AAGCGTCTTG CCCCTGACCA TGAAAGATTT CTATGGGCAC TGAGTATTGT TCAGTCTCGC TCTGTCAATT TGAAACTGAG
AATGGGAGCC TTCCTCCAAG ATGCAAATGT CCTAGTGCCG TATGCTGGTA CATGTTTTCT TATCTGTTCC CCTTTATGCT
CTTTATTTTT ATTTTCAGTG TGTATTAAGC ACCGATTACT AAAATTAAGA ATAAAATCAC TTAGTTTCTT CAGCTTGCGA
TGATAATCAG ATGTCTAACA GTCTAAGTCA AGGCTGCGGT CTGAGGGATC TTTTGCTCCA TTTATTTTGA GCTGGCGAAT
GCTATAAAGG TTTTTATAAT GTTATAGCGC TAATGTTACT TGCACAGTAA ATCATAGTTA CCAACTGATC CAAGATATTA
TATTTTCTAA TATCAGCACT ACTTCTGTAT GGTTAAACTC TGTTGGAATA AGGATCTAAC TAATATCTAT TGTCATTTTT
CACACCAATA CTACGCTTTA TTCCTTCTAG ACGTTCTAGT CAGGCAGTAT AGTTACATTG AATTACTTAA TAATTATCAC
AAAGGCATGA AATTCAAAAC TATACTGTTC TGATAATCAG CATATTCTAG CTTCTGATTA CTGATACTGA GTCTCATCAT
AACTTATAGC TTGCCTATTT GTCTCCAGAT ATGCTGAATC ATTCACCTGA TGCTAATTGT TTCCTGCATT GGCGTTTCAA
AGATCGTATG GTTGAAGTCA TGATTAAGGC TGGGCATGCT GTCAAAAAAG GAGATGAGGT ACTGTTTAGA GCTTAGAGTA
CAATTAGCTT CCTTGTGAGC AAAGAGCGAC TAGTTTAATG TTATATTATA ATTAAAAATT CCTTATTTGC ATGGAAAGTT
GCCAACTTTA CTTAAATGCC ATCCAAAATT TCAAACCAGT TTGATCATTT CATTCTATGG ACCCAGTACA GATGACAATT
GATTATATGA GTGGAGTGAA CAGCTCATTT ATGGAAAGAT ATGGTTTCTC ATCACCAACG GTATGATCAT GTGTTTGATT
TTAATTCTTG CTTGTTCTTG CAAGCCACAT CTGTCCTTTC CCACTTGGCA GGACTTAGCA TTGAGGAATA TTGTGTTGGG
TATAAGTATA ACTATATCTG CGAGATTATG GTTCTGCTTA AAGGAAACAA CTCTAGCATC AAATATGTTG TGCTGCTATG
CTAGATTGCT AGGCATGTTA ATACGATACC ATGCATTGAA ACAACTACAG TGTCATTTTT TTTTTTAAAA AAAATGTGAC
TTCTTATATG GTTGTGTGCA CACAACAAAC ACTACAGAAT CCTTGGGAGC TTATAAACTT CTCGAGTGAT GCCAAGATTC
ATCTTGACTC CTTCCTGTCG GTCTTCAACA TTGCTGGCTT GCATGATGAG CTCTACCACA ATGGTAGGAA CTAGGAACAC
ATGACCTTGC GAACCATTCT GCAACATGCC TTGATTCGGA ACCTTTGATT TGAACTATCC AATGTGTTGC AGCTGCATTG
ACCTCAGGAG AAAACAACTT TGTTGATGGA GGAGTCGTGG CAGCAGCAAG AACTCTGCCG ACATGGTCAG AAGGTGATGT
TCCTGCCATA CCAAGCTTGG AAAGAAAATC TGCTCAGGCA TTACAAGAGG AATGCCATAC GATGCTGGAG TCCTTTTCAA
CCACTATTCA ACAAGACCAG GAGATTCTAG GTAAGGCCCA TCAGGATCCC AAGTATTAAT TTAGCCTTTT TCATAGTCCT
TCCGAGAAAT ACATGCAAAT GATTGGTCTG TAATGTGTTG CAGATTCTGA TGGACATATC AGAAGAACAC GTGAAATCGC
AATCAAGTAT GTGAACTAGC AAGTTGTTTT AGCCATTGCT CCCATGAAGT TTATGTTTGT TTGTACCACT TGCTTGTTAA
CACATTTTTT CTGTTGATAT GCAGATATCG GCTACACCGG AAGCTGCTCC TGCAGAAAAT CATCGATGCA TTGGATATCT
ACCAGGATAA AATTTTGTTT TAGATAGCTG TATAGGCAAC AACTAGTTGA GCTCCAGTGC TAGTTTGCTA AGCGCTGGAG
TGTCTTTAGA TGATTTTGTG AAGGGGGTTT CACTCACATC TGTAACAGTA GGGATTTCAC CTCATTCTTT TAGATATTTC
CACTTTGGTA GATAGCAGTA TAGTGAAATA AAGACAGTGC CCATGAGGTA GTGTAGTTTC CAGCCAGTGA CCTGCAGAAA
ATCAAGtaat ccctctgttt cgaactactt gtgttctagt tttgtcctaa ggtaaacatt ttaatatttg actatcaatt
tctataaact catataGTC

Locus: Os05g0587200

Loading...

Locus: Os05g0587200

Loading...