Os05t0587700-01

Locus

Os05g0587700

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL17, TBL17

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 17

Transcript Evidence

AK064730 (DDBJ, Best hit)

Protein Evidence

B9FIS0 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

002-120-A12 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0587700-01)

Others

Oryzabase (21472)

Transcript

1980 bp

>Os05t0587700-01 Conserved hypothetical protein.
ACATCCATCCCAGTGAAAAGTGCAGTGGCAGAGGCAGAGCAGCCGGTGAAGTAGCAGTTG
GAGCTAAGCTAGCAATGGATCCCCTGAAGCTGAAACCACCCTCCATGGCCACCCGCAAGC
GCCTCGCCGGCGCCGCCCTCGGCTGCCTCTCGCTCTTCCTCCTCTCCCGCGCCCTCCTCT
TCTCCCAAGACGACCCGGAGCCCGTCAAGCGACCGGACGAGGCGTCCTCAATCTCATTGC
CGCCCGACCGCATTGCCATTATTGCTGCTGCACCTGCGCCGAGCCCAGCTACTGCTGCTG
CTTCCGATGGCTCGCCGGCGCCGGCCCAGGATGAAGTCCGGTGCGACCTGTTCGACGGCA
GCTGGGTGTACGACCCGGCCGGCTATCCGCTCTACGACGCCGGGGAGTGCCCCTTCTTGA
GCGACCAGGTCACCTGCCGGAGGAACGGCCGGCCGGACTCCGGCTACGAGCACTGGCGGT
GGCAGCCCAGGCGGTGCGCCGCCGCTCTCAGGTGCGTGGCCACTGCTACCTACCTTGCAT
CTCTTCTGCCTTTTTGAAATTTCTCTTCATTTTGTTTTAAATCCTGGACAGACAAACTAA
AGCTGGTCTCTTTAGTAGATTCTGAATCTGATTTGTTTTTGAAATGCGCATGAATCGTTC
ATGAATGCTCTCCGTTGTGTGTGTGTATCCCCTGTGACACAGTCGTAATCGATGGCTAAA
ATGAACAAGCCCGTGCAAGTCGCACTGTCTCAGGGCCCGTTCTTGGATACAAAAGGTAAA
TGAAAAGTGGGTAAAGTTGTCAACTTGTGACGATGTGCGTTGCTTTTGAGTTGGGAACAC
AGCTCTGACAGTGCCCTGTGCATAGTACTACTAGTGTTATGGCAGTAATTAATTATTTTT
CACTTTGAAACACATAGTTGACACTAGTTGCACACATGACAACCAACCACGGTCACTGTT
CCTGATTCCTCCGGTGCATCATTCCGACCGGAATAATCGTGTTGATTCTCCATGAGTAAT
CCTCTGCAAATCGCACACGTCGCACTGAATAATGCTTCACTTTTTTATCAGGCTGCGTGG
TGGGGAGATGCTGGAGCAGTGCCGGGACAAGCGAGTGGTGCTCGTCGGCGACTCGCTCAA
CCGCAACATGTGGGAGTCGCTCGCCTGCATCCTCTACGCCGCGGCGCCCGACCGCTCACG
CGCCACCGTCGACGACGCCAGCGCCGACCACAAGATCTTCCAAGCATTGGATTACAACTG
CACGGTGGAGTTCTACTGGAGCCCGTTCCTGGTGGACCTCGACGACCAGACCAGGGTGCT
GAAGCTGGACCGCCTCCCGGCGACGACGTATCGCCGGCTCGCCGCCGCCGACGTGCTGGT
GTTCAACACGGGCCACTGGTGGACGCACACCGGCAAGTTCAGGGCGTGGGATCACCTGGA
GAGGAACGGGAAGAAGGTGGAGATGGGAGCGGAGGAAGCCTTCAACCGCGCGCTCCGGAC
ATGGACGCGGTGGCTCGATCGAAACGTGGACTCTCACAAGACCATGGTGTTCTTCCGCAG
CATCTCCCCCGAGCACAAGAACAAGAACTGGTGCTACAACGAGACGGCTCCGATGGCGAG
GGCGGAGGAGTACGTGGAGGCGTTCCCGAGAGGGATGGTGTCGATCGTGGAGAGGAACGT
GAGGAGGGCGAGGACGGCGGTGGGGTACCTGGACATCACCCGGCTGTCGGAGCTCCGGCG
AGACGCGCACCCGTCAGTGTTCACGGTCAGGGGAGGGAAGCTGCTGACGCCGGAGCAGAG
GCGGCAGCCGGGATCGTACGCCGACTGCAGCCACTGGTGCCTGCCCGGGCTGCCTGACAC
GTGGAACCTTCTCCTCTTTGCCTCCTGGACCTCGCTTCGATCCTGAGATCATCTCTTCTT
CTCCATTGTCGATGCGCCATTGATGCATCATGCATGTATATATAGGATTAATTGTTGCTG

CDS

483 bp

>Os05t0587700-01 Conserved hypothetical protein.
ATGGATCCCCTGAAGCTGAAACCACCCTCCATGGCCACCCGCAAGCGCCTCGCCGGCGCC
GCCCTCGGCTGCCTCTCGCTCTTCCTCCTCTCCCGCGCCCTCCTCTTCTCCCAAGACGAC
CCGGAGCCCGTCAAGCGACCGGACGAGGCGTCCTCAATCTCATTGCCGCCCGACCGCATT
GCCATTATTGCTGCTGCACCTGCGCCGAGCCCAGCTACTGCTGCTGCTTCCGATGGCTCG
CCGGCGCCGGCCCAGGATGAAGTCCGGTGCGACCTGTTCGACGGCAGCTGGGTGTACGAC
CCGGCCGGCTATCCGCTCTACGACGCCGGGGAGTGCCCCTTCTTGAGCGACCAGGTCACC
TGCCGGAGGAACGGCCGGCCGGACTCCGGCTACGAGCACTGGCGGTGGCAGCCCAGGCGG
TGCGCCGCCGCTCTCAGGTGCGTGGCCACTGCTACCTACCTTGCATCTCTTCTGCCTTTT
TGA

Protein

161 aa

>Os05t0587700-01 Conserved hypothetical protein.
MDPLKLKPPSMATRKRLAGAALGCLSLFLLSRALLFSQDDPEPVKRPDEASSISLPPDRI
AIIAAAPAPSPATAAASDGSPAPAQDEVRCDLFDGSWVYDPAGYPLYDAGECPFLSDQVT
CRRNGRPDSGYEHWRWQPRRCAAALRCVATATYLASLLPF*

5'UTR

chr05:29286777..29286850 (- strand) : 74 bp

CDS

chr05:29286294..29286776 (- strand) : 483 bp

3'UTR

chr05:29285602..29286293 (- strand) : 692 bp

chr05:29285323..29285498 (- strand) : 176 bp

chr05:29285086..29285241 (- strand) : 156 bp

chr05:29284596..29284994 (- strand) : 399 bp

FASTA

>Os05t0587700-01 class=Sequence position=chr05:29284596..29286850 (- strand)
ACATCCATCC CAGTGAAAAG TGCAGTGGCA GAGGCAGAGC AGCCGGTGAA GTAGCAGTTG GAGCTAAGCT AGCAATGGAT
CCCCTGAAGC TGAAACCACC CTCCATGGCC ACCCGCAAGC GCCTCGCCGG CGCCGCCCTC GGCTGCCTCT CGCTCTTCCT
CCTCTCCCGC GCCCTCCTCT TCTCCCAAGA CGACCCGGAG CCCGTCAAGC GACCGGACGA GGCGTCCTCA ATCTCATTGC
CGCCCGACCG CATTGCCATT ATTGCTGCTG CACCTGCGCC GAGCCCAGCT ACTGCTGCTG CTTCCGATGG CTCGCCGGCG
CCGGCCCAGG ATGAAGTCCG GTGCGACCTG TTCGACGGCA GCTGGGTGTA CGACCCGGCC GGCTATCCGC TCTACGACGC
CGGGGAGTGC CCCTTCTTGA GCGACCAGGT CACCTGCCGG AGGAACGGCC GGCCGGACTC CGGCTACGAG CACTGGCGGT
GGCAGCCCAG GCGGTGCGCC GCCGCTCTCA GGTGCGTGGC CACTGCTACC TACCTTGCAT CTCTTCTGCC TTTTTGAAAT
TTCTCTTCAT TTTGTTTTAA ATCCTGGACA GACAAACTAA AGCTGGTCTC TTTAGTAGAT TCTGAATCTG ATTTGTTTTT
GAAATGCGCA TGAATCGTTC ATGAATGCTC TCCGTTGTGT GTGTGTATCC CCTGTGACAC AGTCGTAATC GATGGCTAAA
ATGAACAAGC CCGTGCAAGT CGCACTGTCT CAGGGCCCGT TCTTGGATAC AAAAGGTAAA TGAAAAGTGG GTAAAGTTGT
CAACTTGTGA CGATGTGCGT TGCTTTTGAG TTGGGAACAC AGCTCTGACA GTGCCCTGTG CATAGTACTA CTAGTGTTAT
GGCAGTAATT AATTATTTTT CACTTTGAAA CACATAGTTG ACACTAGTTG CACACATGAC AACCAACCAC GGTCACTGTT
CCTGATTCCT CCGGTGCATC ATTCCGACCG GAATAATCGT GTTGATTCTC CATGAGTAAT CCTCTGCAAA TCGCACACGT
CGCACTGAAT AATGCTTCAC TTTTTTATCA GGCTGCGTGG TGGGGAGATG CTGGAGCAGT GCCGGGACAA GCGAGTGGTG
CTCGTCGGCG ACTCGCTCAA CCGCAACATG TGGGAGTCGC TCGCCTGCAT CCTCTACGCC GCGGCGCCCG ACCGCTCACG
CGCCACCGTC GACGACGCCA GCGCCGACCA CAAGATCTTC CAAGCATTGG TAACTAAAGA CAAACCAAAA AAAAAAAACT
TTTGCATTTT ACTACTACTC ATCAGCAAAT CAAACCGAAA TTCAGTTGAA CTTTTTTTGC GATCACGGAC AGGATTACAA
CTGCACGGTG GAGTTCTACT GGAGCCCGTT CCTGGTGGAC CTCGACGACC AGACCAGGGT GCTGAAGCTG GACCGCCTCC
CGGCGACGAC GTATCGCCGG CTCGCCGCCG CCGACGTGCT GGTGTTCAAC ACGGGCCACT GGTGGACGCA CACCGGCAAG
TTCAGGGCGT AAGGCTTCTC AGCTCCAGAC CTCATCAAAA TCATCCGCGT CCATGGCTTG ACACAGACTT GACGACTACT
GCATTGCAGG TGGGATCACC TGGAGAGGAA CGGGAAGAAG GTGGAGATGG GAGCGGAGGA AGCCTTCAAC CGCGCGCTCC
GGACATGGAC GCGGTGGCTC GATCGAAACG TGGACTCTCA CAAGACCATG GTGTTCTTCC GCAGCATCTC CCCCGAGCAC
AAGAAGTTCG TAAACTCGAT CGAATTTCAA CTGATTATCA GCTTAATTAC TTGATCTTAA CATTGGAAAA CAATGACATG
ATTGGCATTG GCACAGCAAG AACTGGTGCT ACAACGAGAC GGCTCCGATG GCGAGGGCGG AGGAGTACGT GGAGGCGTTC
CCGAGAGGGA TGGTGTCGAT CGTGGAGAGG AACGTGAGGA GGGCGAGGAC GGCGGTGGGG TACCTGGACA TCACCCGGCT
GTCGGAGCTC CGGCGAGACG CGCACCCGTC AGTGTTCACG GTCAGGGGAG GGAAGCTGCT GACGCCGGAG CAGAGGCGGC
AGCCGGGATC GTACGCCGAC TGCAGCCACT GGTGCCTGCC CGGGCTGCCT GACACGTGGA ACCTTCTCCT CTTTGCCTCC
TGGACCTCGC TTCGATCCTG AGATCATCTC TTCTTCTCCA TTGTCGATGC GCCATTGATG CATCATGCAT GTATATATAG
GATTAATTGT TGCTG

Locus: Os05g0587700

Loading...

Locus: Os05g0587700

Loading...