Os05t0588500-01

Locus

Os05g0588500

Description

Sugar transporter, Galactose transport

RAP-DB Gene Symbol Synonym(s)

SWEET5, OsSWEET5

RAP-DB Gene Name Synonym(s)

SWEET5

CGSNL Gene Symbol

SWEET5

CGSNL Gene Name

SWEET5

Oryzabase Gene Symbol Synonym(s)

OsSWEET5

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK069614

Protein Evidence

Q6L568

Literature

PMID: 24709840

Note

Manual Curation

March 4, 2015

Full-length cDNA

J023023E05 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0588500-01)

RiceXPro (AK069614)

Others

Oryzabase (9095)

KEGG (Os05t0588500-01)

Transcript

1362 bp

>Os05t0588500-01 Sugar transporter, Galactose transport
GTGCTCTGCCTCTCCATTATTCCGACTCTCGTAAGATTAAGGGGGGAGGAATTGGAGGGC
AGAGGCCGCCATTTTAATCAGTGGAAATAAAATCCACGCATTTTATATATTTAATTTAAC
CCCCAATTTTAACTTAGCAGCACACTAGCTAGCTAGCTGCTAAGTTAACTATTTGATCAG
GTTACAGTTGCTGGCCTGACAGTTAATTAATCTCTTGCTGGTTGATTAGTTGCTATCAGC
TACACGCTCTCGCTAGCTGCCACTGTACTAATACATACTCCCATCTATTCGCCTGAGAAA
ATATCGAAAAGTAGCAGCAAAGAGGAGCAGGCAAGATGGTGATGAACCCTGACGCCGTCC
GCAATGTCGTTGGAATCATCGGTAACTTGATATCGTTCGGGTTGTTCTTGTCGCCATTGC
CGACGTTCGTGACGATCGTGAAGAAGAAGGACGTGGAGGAGTTCGTGCCGGATCCGTACC
TGGCGACGTTCCTCAACTGCGCGCTGTGGGTGTTCTACGGCCTACCCTTCATCCACCCCA
ACAGCATCCTCGTCGTCACCATCAACGGCACCGGACTCCTCATCGAGATCGCCTACCTCG
CCATCTACTTCGCCTACGCCCCCAAGCCCAAGCGGTGCAGGATGCTCGGCGTCCTCACCG
TGGAGCTCGTCTTCCTCGCCGCCGTCGCCGCCGGCGTGCTCCTCGGCGCCCACACCTACG
ACAAGCGCTCGCTCATCGTTGGCACCCTCTGCGTCTTCTTCGGCACCCTCATGTACGCCG
CGCCGCTCACCATCATGAAACAAGTGATCGCGACAAAGAGCGTGGAGTACATGCCCTTCA
CGTTGTCGCTGGTGAGCTTCATCAACGGCATATGCTGGACAATATACGCGTTCATCCGCT
TTGACATCCTCATCACGATACCGAACGGCATGGGGACGCTGCTGGGCGCGGCGCAGTTGA
TCCTCTACTTCTGCTACTACGACGGGTCGACGGCCAAGAACAAGGGCGCCCTCGAGCTGC
CCAAGGACGGCGACTCCTCCGCTGTGTAGCTACATATGCTATATATCTTGCCATGCAAAG
AACCACAAGATCGAAGCTAACACAAACCATGCAGCATATATGCACATCACACATGCAGTA
TCACAACGTACGCATGCTTGGATCTGCACGCACCACGCGCGCGTGCATGTAACTGTGACG
GGTTATAATCGATCTGTTGGATGGATATGGATCATGGATGCAGGCAATGCAGCTGCTCTT
CTGTTTGGACCCACTGAATTCGCCCGTGCATGCAGGCAGCTTCTTTGTGTGTGTACATAT
CCAACTATGCAAGAGGCAGGTATATGTGAGCAAAAGGCCCCC

CDS

714 bp

>Os05t0588500-01 Sugar transporter, Galactose transport
ATGGTGATGAACCCTGACGCCGTCCGCAATGTCGTTGGAATCATCGGTAACTTGATATCG
TTCGGGTTGTTCTTGTCGCCATTGCCGACGTTCGTGACGATCGTGAAGAAGAAGGACGTG
GAGGAGTTCGTGCCGGATCCGTACCTGGCGACGTTCCTCAACTGCGCGCTGTGGGTGTTC
TACGGCCTACCCTTCATCCACCCCAACAGCATCCTCGTCGTCACCATCAACGGCACCGGA
CTCCTCATCGAGATCGCCTACCTCGCCATCTACTTCGCCTACGCCCCCAAGCCCAAGCGG
TGCAGGATGCTCGGCGTCCTCACCGTGGAGCTCGTCTTCCTCGCCGCCGTCGCCGCCGGC
GTGCTCCTCGGCGCCCACACCTACGACAAGCGCTCGCTCATCGTTGGCACCCTCTGCGTC
TTCTTCGGCACCCTCATGTACGCCGCGCCGCTCACCATCATGAAACAAGTGATCGCGACA
AAGAGCGTGGAGTACATGCCCTTCACGTTGTCGCTGGTGAGCTTCATCAACGGCATATGC
TGGACAATATACGCGTTCATCCGCTTTGACATCCTCATCACGATACCGAACGGCATGGGG
ACGCTGCTGGGCGCGGCGCAGTTGATCCTCTACTTCTGCTACTACGACGGGTCGACGGCC
AAGAACAAGGGCGCCCTCGAGCTGCCCAAGGACGGCGACTCCTCCGCTGTGTAG

Protein

238 aa

>Os05t0588500-01 Sugar transporter, Galactose transport
MVMNPDAVRNVVGIIGNLISFGLFLSPLPTFVTIVKKKDVEEFVPDPYLATFLNCALWVF
YGLPFIHPNSILVVTINGTGLLIEIAYLAIYFAYAPKPKRCRMLGVLTVELVFLAAVAAG
VLLGAHTYDKRSLIVGTLCVFFGTLMYAAPLTIMKQVIATKSVEYMPFTLSLVSFINGIC
WTIYAFIRFDILITIPNGMGTLLGAAQLILYFCYYDGSTAKNKGALELPKDGDSSAV*

5'UTR

chr05:29314534..29314868 (- strand) : 335 bp

CDS

chr05:29314488..29314533 (- strand) : 46 bp

chr05:29313895..29314310 (- strand) : 416 bp

chr05:29313657..29313776 (- strand) : 120 bp

chr05:29313370..29313501 (- strand) : 132 bp

3'UTR

chr05:29313057..29313369 (- strand) : 313 bp

FASTA

>Os05t0588500-01 class=Sequence position=chr05:29313057..29314868 (- strand)
GTGCTCTGCC TCTCCATTAT TCCGACTCTC GTAAGATTAA GGGGGGAGGA ATTGGAGGGC AGAGGCCGCC ATTTTAATCA
GTGGAAATAA AATCCACGCA TTTTATATAT TTAATTTAAC CCCCAATTTT AACTTAGCAG CACACTAGCT AGCTAGCTGC
TAAGTTAACT ATTTGATCAG GTTACAGTTG CTGGCCTGAC AGTTAATTAA TCTCTTGCTG GTTGATTAGT TGCTATCAGC
TACACGCTCT CGCTAGCTGC CACTGTACTA ATACATACTC CCATCTATTC GCCTGAGAAA ATATCGAAAA GTAGCAGCAA
AGAGGAGCAG GCAAGATGGT GATGAACCCT GACGCCGTCC GCAATGTCGT TGGAATCATC GGTACGTCGT CTCGAATTGA
ACCTGCTTGT AGATGCTTCA TATATATATA TATATATATA TATATATATA TATATATATA TATATATATA TATATATATA
TATATATATA TATATATATA TATATATATA TATTGATCGA ACATTAGTAA TTGACTAATA ATTGATTAAT TGTACTAGGT
AACTTGATAT CGTTCGGGTT GTTCTTGTCG CCATTGCCGA CGTTCGTGAC GATCGTGAAG AAGAAGGACG TGGAGGAGTT
CGTGCCGGAT CCGTACCTGG CGACGTTCCT CAACTGCGCG CTGTGGGTGT TCTACGGCCT ACCCTTCATC CACCCCAACA
GCATCCTCGT CGTCACCATC AACGGCACCG GACTCCTCAT CGAGATCGCC TACCTCGCCA TCTACTTCGC CTACGCCCCC
AAGCCCAAGC GGTGCAGGAT GCTCGGCGTC CTCACCGTGG AGCTCGTCTT CCTCGCCGCC GTCGCCGCCG GCGTGCTCCT
CGGCGCCCAC ACCTACGACA AGCGCTCGCT CATCGTTGGC ACCCTCTGCG TCTTCTTCGG CACCCTCATG TACGCCGCGC
CGCTCACCAT CATGGTATGT GTATATATAT CTGTCGATTA TTAATTTTTT GCATGAATCT GATCTGATGA TTAATTATTT
GATTTATATG TGTGTGGCAA AATGATGTAA TTACTACATG GAATGAATGT AGAAACAAGT GATCGCGACA AAGAGCGTGG
AGTACATGCC CTTCACGTTG TCGCTGGTGA GCTTCATCAA CGGCATATGC TGGACAATAT ACGCGTTCAT CCGCTTTGAC
ATCCTCATCA CGGTATACAT ATTATGCATG CATATATATA TATATGCTTT CAATTATCTC ATAAATAATT ACTAGGATCA
GTAAGTAGTA TAGTTGTTAT TATAATCATA GAGTAATTCT AGCTAATAGT ACTATATATT AATGTATCAT AATTAATAAA
TAAATAGATA CCGAACGGCA TGGGGACGCT GCTGGGCGCG GCGCAGTTGA TCCTCTACTT CTGCTACTAC GACGGGTCGA
CGGCCAAGAA CAAGGGCGCC CTCGAGCTGC CCAAGGACGG CGACTCCTCC GCTGTGTAGC TACATATGCT ATATATCTTG
CCATGCAAAG AACCACAAGA TCGAAGCTAA CACAAACCAT GCAGCATATA TGCACATCAC ACATGCAGTA TCACAACGTA
CGCATGCTTG GATCTGCACG CACCACGCGC GCGTGCATGT AACTGTGACG GGTTATAATC GATCTGTTGG ATGGATATGG
ATCATGGATG CAGGCAATGC AGCTGCTCTT CTGTTTGGAC CCACTGAATT CGCCCGTGCA TGCAGGCAGC TTCTTTGTGT
GTGTACATAT CCAACTATGC AAGAGGCAGG TATATGTGAG CAAAAGGCCC CC

Locus: Os05g0588500

Loading...

Locus: Os05g0588500

Loading...