Os05t0592800-02

Locus

Os05g0592800

Description

Clade A type 2C protein phosphatase, ABA signaling, Regulation of root development, Drought resistance, Stomatal closure

RAP-DB Gene Symbol Synonym(s)

OsABIL2, OsPP2C53, PP2C53, OsPP81

RAP-DB Gene Name Synonym(s)

OsABI-LIKE2, protein phosphatase 2C53, protein phosphatase 2C 53, protein phosphatase 81

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPP2C53, PP2C53, OsPP81, OsABIL2, ABIL2

Oryzabase Gene Name Synonym(s)

protein phosphatase 2C53, protein phosphatase 2C 53, protein phosphatase 81, OsABI-LIKE2, ABI-LIKE2, ABI-LIKE 2

Transcript Evidence

AK067627

Protein Evidence

Q6L4R7

Literature

PMID: 31134357

PMID: 26491145

PMID: 19021904

Note

Manual Curation

May 29, 2019

Gene Ontology (GO)

Biological Process: protein dephosphorylation (GO:0006470)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein serine/threonine phosphatase activity (GO:0004722)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Protein phosphatase 2C family (IPR015655)

PPM-type phosphatase domain (IPR001932)

PPM-type phosphatase, divalent cation binding (IPR000222)

Full-length cDNA

J013113I18 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0592800-02)

RiceXPro (AK067627)

Others

Oryzabase (17926)

KEGG (Os05t0592800-02 (EC:3.1.3.16))

Transcript

2168 bp

>Os05t0592800-02 Clade A type 2C protein phosphatase, ABA signaling, Regulation of root development, Drought resistance, Stomatal closure
ACCCGCCAGCCAGCCAGCGCCTCCTCCCCTCTCCTCCCCACGCAACCCGATCCATTCCCA
AATCCCTCCTCTCATCAACTCGACTCTCGGTCGGCGTCACCGGCGTCGGAGGCGGAGGCG
GAGGCGGCGGCCGCGTCGGCAAGGTAGTGCTGTGCTGGATCGAGTCGAGCAGCTGGCTGC
GCGCGCGGTTTGTGGCTCTCTGTGTGAGTCCGGCGCTGCTGCTTCAATTCCTTCTTCCCC
AGGGCACCTCCCGTGAGCCGCCATCTCCCTCCCTCACCTACCTCTGGATTCGCTCCAGAT
CCGCCCATGAGTAGGCCCCCACGCCCACCGCCTGCTCGCCATCGCGCCTCCACTCCACCA
CACCATGCCGATCCCCACCACCTCTGACACTACTCCGCCCCTCCCCCTCTCTCATTCCCA
TGGAGGACCTCGCCCTGCCCGCCGCTCCTCCTGCCCCCACGCTTAGCTTCACGCTCTTAG
CCGCCGCCGCCGCCGTCGCCGAGGCCATGGAAGAGGCTCTGGGCGCCGCGCTGCCGCCCC
TCACCGCCCCCGTCCCCGCCCCCGGAGACGACTCCGCCTGCGGGAGCCCGTGCTCCGTCG
CCAGCGACTGCAGCAGCGTCGCCAGCGCCGACTTCGAGGGCTTCGCCGAGCTAGGCACTT
CGCTCCTCGCGGGGCCCGCCGTCTTGTTCGACGACCTCACCGCCGCCTCCGTCGCCGTCG
CGGAGGCTGCCGAGCCGAGGGCTGTGGGGGCCACTGCGAGGAGCGTGTTCGCCATGGACT
GCGTTCCGCTCTGGGGGCTGGAGTCCATTTGCGGCCGCCGCCCGGAGATGGAGGACGACT
ATGCCGTGGTCCCGCGATTTTTCGACCTTCCTCTGTGGATGGTTGCCGGCGACGCGGCAG
TCGACGGCCTCGACCGGGCCTCCTTCCGCCTTCCAGCCCATTTCTTCGCCGTCTACGATG
GCCACGGTGGCGTTCAGGTTGCCAATTACTGCAGGAAGAGGATCCACGCCGTACTGACAG
AGGAGCTGCGTAGAGCGGAGGACGACGCGTGTGGCTCTGACTTATCTGGCCTTGAGTCCA
AGAAGCTGTGGGAGAAGGCGTTCGTGGATTGCTTCAGTCGTGTTGACGCTGAGGTGGGAG
GAAATGCTGCGTCTGGAGCACCGCCTGTTGCTCCAGACACCGTGGGGTCAACTGCTGTCG
TCGCAGTCGTTTGCTCGTCACATGTCATCGTAGCCAACTGCGGTGACTCGCGTGCTGTTC
TCTGCCGGGGCAAGCAGCCCCTGCCCCTGTCACTAGATCATAAACCAAATAGGGAAGACG
AGTACGCGAGGATTGAGGCGCTGGGTGGCAAGGTTATCCAATGGAATGGTTATCGAGTTC
TCGGTGTTCTTGCCATGTCGCGATCAATCGGGGACAAATACCTGAAGCCATATATAATCC
CGGTCCCTGAGGTCACAGTTGTCGCTCGTGCAAAAGACGATGATTGCCTTATTCTTGCAA
GTGATGGCCTTTGGGATGTAATGTCGAACGAAGAGGTCTGTGATGCTGCTCGCAAGAGGA
TATTACTATGGCACAAGAAGAATGCGGCCACCGCATCAACGTCATCGGCCCAAATAAGCG
GTGATTCTTCAGATCCGGCTGCTCAAGCAGCTGCCGACTACTTGTCCAAGCTTGCCCTAC
AGAAGGGGAGCAAGGACAACATCACTGTCGTTGTAATTGACCTCAAGGCACATAGGAAGT
TCAAGAGCAAAGCATGACATTGCCTCCATGAACAATAACAATAGTTTATAGGAAGCTAGA
AATGTGGGAAATCCAAGACAATTTATTTAGCTGCTGCACCGGTACAATTTGTTTAGCTGC
TGTTCAGTACTGGTGCTGCTGCAGCTGCAGCTGCTTCTTTGCCCTCGCCATTTATTTCTG
CCGAGGGATGTACTACTAGTATACTGTATTTTTCTACACGGTACAGACTCCCAAATCTGA
TTCAGGGTCGAGGACATAAGGTGGATCTGGGAATTTTGGGGTCTCTCAAGACAAGACAGA
AAACATAACAAAATCTGTAGATGTAGGTAGGAGTCCTAGGACAGATTGGGTTTCTGCCTC
TGGCATTAATCGTTTTTGTTAACCGGTAAAGATACTGCTACTTGCAATTGCTGTTTCATA
TATACTCC

CDS

1338 bp

>Os05t0592800-02 Clade A type 2C protein phosphatase, ABA signaling, Regulation of root development, Drought resistance, Stomatal closure
ATGGAGGACCTCGCCCTGCCCGCCGCTCCTCCTGCCCCCACGCTTAGCTTCACGCTCTTA
GCCGCCGCCGCCGCCGTCGCCGAGGCCATGGAAGAGGCTCTGGGCGCCGCGCTGCCGCCC
CTCACCGCCCCCGTCCCCGCCCCCGGAGACGACTCCGCCTGCGGGAGCCCGTGCTCCGTC
GCCAGCGACTGCAGCAGCGTCGCCAGCGCCGACTTCGAGGGCTTCGCCGAGCTAGGCACT
TCGCTCCTCGCGGGGCCCGCCGTCTTGTTCGACGACCTCACCGCCGCCTCCGTCGCCGTC
GCGGAGGCTGCCGAGCCGAGGGCTGTGGGGGCCACTGCGAGGAGCGTGTTCGCCATGGAC
TGCGTTCCGCTCTGGGGGCTGGAGTCCATTTGCGGCCGCCGCCCGGAGATGGAGGACGAC
TATGCCGTGGTCCCGCGATTTTTCGACCTTCCTCTGTGGATGGTTGCCGGCGACGCGGCA
GTCGACGGCCTCGACCGGGCCTCCTTCCGCCTTCCAGCCCATTTCTTCGCCGTCTACGAT
GGCCACGGTGGCGTTCAGGTTGCCAATTACTGCAGGAAGAGGATCCACGCCGTACTGACA
GAGGAGCTGCGTAGAGCGGAGGACGACGCGTGTGGCTCTGACTTATCTGGCCTTGAGTCC
AAGAAGCTGTGGGAGAAGGCGTTCGTGGATTGCTTCAGTCGTGTTGACGCTGAGGTGGGA
GGAAATGCTGCGTCTGGAGCACCGCCTGTTGCTCCAGACACCGTGGGGTCAACTGCTGTC
GTCGCAGTCGTTTGCTCGTCACATGTCATCGTAGCCAACTGCGGTGACTCGCGTGCTGTT
CTCTGCCGGGGCAAGCAGCCCCTGCCCCTGTCACTAGATCATAAACCAAATAGGGAAGAC
GAGTACGCGAGGATTGAGGCGCTGGGTGGCAAGGTTATCCAATGGAATGGTTATCGAGTT
CTCGGTGTTCTTGCCATGTCGCGATCAATCGGGGACAAATACCTGAAGCCATATATAATC
CCGGTCCCTGAGGTCACAGTTGTCGCTCGTGCAAAAGACGATGATTGCCTTATTCTTGCA
AGTGATGGCCTTTGGGATGTAATGTCGAACGAAGAGGTCTGTGATGCTGCTCGCAAGAGG
ATATTACTATGGCACAAGAAGAATGCGGCCACCGCATCAACGTCATCGGCCCAAATAAGC
GGTGATTCTTCAGATCCGGCTGCTCAAGCAGCTGCCGACTACTTGTCCAAGCTTGCCCTA
CAGAAGGGGAGCAAGGACAACATCACTGTCGTTGTAATTGACCTCAAGGCACATAGGAAG
TTCAAGAGCAAAGCATGA

Protein

445 aa

>Os05t0592800-02 Clade A type 2C protein phosphatase, ABA signaling, Regulation of root development, Drought resistance, Stomatal closure
MEDLALPAAPPAPTLSFTLLAAAAAVAEAMEEALGAALPPLTAPVPAPGDDSACGSPCSV
ASDCSSVASADFEGFAELGTSLLAGPAVLFDDLTAASVAVAEAAEPRAVGATARSVFAMD
CVPLWGLESICGRRPEMEDDYAVVPRFFDLPLWMVAGDAAVDGLDRASFRLPAHFFAVYD
GHGGVQVANYCRKRIHAVLTEELRRAEDDACGSDLSGLESKKLWEKAFVDCFSRVDAEVG
GNAASGAPPVAPDTVGSTAVVAVVCSSHVIVANCGDSRAVLCRGKQPLPLSLDHKPNRED
EYARIEALGGKVIQWNGYRVLGVLAMSRSIGDKYLKPYIIPVPEVTVVARAKDDDCLILA
SDGLWDVMSNEEVCDAARKRILLWHKKNAATASTSSAQISGDSSDPAAQAAADYLSKLAL
QKGSKDNITVVVIDLKAHRKFKSKA*

5'UTR

chr05:29541597..29542015 (- strand) : 419 bp

CDS

chr05:29541039..29541596 (- strand) : 558 bp

chr05:29540612..29540938 (- strand) : 327 bp

chr05:29540409..29540514 (- strand) : 106 bp

chr05:29538874..29539220 (- strand) : 347 bp

3'UTR

chr05:29538463..29538873 (- strand) : 411 bp

FASTA

>Os05t0592800-02 class=Sequence position=chr05:29538463..29542015 (- strand)
ACCCGCCAGC CAGCCAGCGC CTCCTCCCCT CTCCTCCCCA CGCAACCCGA TCCATTCCCA AATCCCTCCT CTCATCAACT
CGACTCTCGG TCGGCGTCAC CGGCGTCGGA GGCGGAGGCG GAGGCGGCGG CCGCGTCGGC AAGGTAGTGC TGTGCTGGAT
CGAGTCGAGC AGCTGGCTGC GCGCGCGGTT TGTGGCTCTC TGTGTGAGTC CGGCGCTGCT GCTTCAATTC CTTCTTCCCC
AGGGCACCTC CCGTGAGCCG CCATCTCCCT CCCTCACCTA CCTCTGGATT CGCTCCAGAT CCGCCCATGA GTAGGCCCCC
ACGCCCACCG CCTGCTCGCC ATCGCGCCTC CACTCCACCA CACCATGCCG ATCCCCACCA CCTCTGACAC TACTCCGCCC
CTCCCCCTCT CTCATTCCCA TGGAGGACCT CGCCCTGCCC GCCGCTCCTC CTGCCCCCAC GCTTAGCTTC ACGCTCTTAG
CCGCCGCCGC CGCCGTCGCC GAGGCCATGG AAGAGGCTCT GGGCGCCGCG CTGCCGCCCC TCACCGCCCC CGTCCCCGCC
CCCGGAGACG ACTCCGCCTG CGGGAGCCCG TGCTCCGTCG CCAGCGACTG CAGCAGCGTC GCCAGCGCCG ACTTCGAGGG
CTTCGCCGAG CTAGGCACTT CGCTCCTCGC GGGGCCCGCC GTCTTGTTCG ACGACCTCAC CGCCGCCTCC GTCGCCGTCG
CGGAGGCTGC CGAGCCGAGG GCTGTGGGGG CCACTGCGAG GAGCGTGTTC GCCATGGACT GCGTTCCGCT CTGGGGGCTG
GAGTCCATTT GCGGCCGCCG CCCGGAGATG GAGGACGACT ATGCCGTGGT CCCGCGATTT TTCGACCTTC CTCTGTGGAT
GGTTGCCGGC GACGCGGCAG TCGACGGCCT CGACCGGGCC TCCTTCCGCC TTCCAGCCCA TTTCTTCGCC GTCTACGATG
GCCACGGTGG CGTTCAGGTT CCCTTTGCTT TTGTTTTTGC CTCATCACAG TCACAGCACA TTAAACGAAT CCAACACACC
GATGATAACC TTTTCTCCAT GCTCTCATCT GTTGCAGGTT GCCAATTACT GCAGGAAGAG GATCCACGCC GTACTGACAG
AGGAGCTGCG TAGAGCGGAG GACGACGCGT GTGGCTCTGA CTTATCTGGC CTTGAGTCCA AGAAGCTGTG GGAGAAGGCG
TTCGTGGATT GCTTCAGTCG TGTTGACGCT GAGGTGGGAG GAAATGCTGC GTCTGGAGCA CCGCCTGTTG CTCCAGACAC
CGTGGGGTCA ACTGCTGTCG TCGCAGTCGT TTGCTCGTCA CATGTCATCG TAGCCAACTG CGGTGACTCG CGTGCTGTTC
TCTGCCGGGG CAAGCAGCCC CTGCCCCTGT CACTAGATCA TAAAGTAAGC CATGGACTCC CATTGATTCC ATGTATGAGT
AATTGACTCG AGTCCTGAGG ATAATTGGAT ACGAATTGCC TTGTTCTTCT TCGTGCTTCA GCCAAATAGG GAAGACGAGT
ACGCGAGGAT TGAGGCGCTG GGTGGCAAGG TTATCCAATG GAATGGTTAT CGAGTTCTCG GTGTTCTTGC CATGTCGCGA
TCAATCGGTA TGCATTCTCA CCCTTTTGAC ATAATTGAAC CAGTGTTTGT TTGTGCTTCA TTGTTTATGC TTCTCCAACT
TTACTGATGT GACTGTGCTG ATGATAGCTG ATTGGGTAAT TGATGTGTCA AAGGAAAAGT CTCTTGACTG GTTCATTTTG
TTATTTTGTT CTGAATTGTG ATGATATATG GTGCTCTAGG GTTTGTGACT TTTCTAAGTG AAAAATCACT GGCTGATTGT
TGCTCCCTGG TGTAATGACA TTGTACCCCC AAGTTTATTT ACAAATACCT TGCATCAATG CGATTGTTTG CAACTGGTAG
TGAGTTTGTA CCTATGGTGG CAGAGAGAGC TCCTCGGCTA ATTACTTTGT TAGTTTGTTC CTAGTCATAC TGTTAAGTGA
TTTGCGATGC TATGATTCAG GCATATATTT CTATATTTGT TAGCTATGTT GCCATATGCG ATACTGGTAT AGGCGTTTGG
TGAGTATACA TGCAGTTCAC AATAGGAAAA TATAAGAGAA TATGAGAGAC TTAGACATTG AGATCACCTT GATGGAAAAA
TATTAAGAGT AATACTAAAT GGCAGAATAC TTCAAAGTAG TGATTTCTGT CATACCAAAC ACTAGGATGA GTCACTAACT
ACACGACAGC TGTATAAGCC ATTGTTTGCA TTCATTGTGA TCAAGGAACA GCTGTACTAT ATCGAGGATT GTAAGGACTG
ATGTAATAAT GTGCCATTGT GCATCAATTG AGCTTTGGAT GTTAGCTTCA CACCTTCACC CATGTTGCTG CACAGCAGTC
AATCATATTT GTTAATTTAC TGTTGCAGTC AGATGAGGTT TCTTCCCATT GAATCTTAAG GGAGAAAGCC TGGCCCAATA
TATATCACAA GACTTGAATA ACTCTTTCAT CAGCATTTAC TCTGATTCGC TTTTGCTGTA TTGATGCTTC AAACTAGAGA
GAGAATCATA ACATCATGCT ATTCTTCTGT TGTACCCCGG TTTATTAGTT CCAGTGTTCA TGTATCCTGT CAGTTTTTGT
TGCTCTTAAC ATGTTATTCT GTGACTGGTA ATTTGATTTC AATGTCTTTA ATATATGGCT TTTGTTGATA CTTCAAAGTT
CAAAGTAGAT AAATTATGTT TGATTTATTG GTGCGCTTGC CAATACTTCT GGTCTGTGCA TTGATGTATT TGCAGGGGAC
AAATACCTGA AGCCATATAT AATCCCGGTC CCTGAGGTCA CAGTTGTCGC TCGTGCAAAA GACGATGATT GCCTTATTCT
TGCAAGTGAT GGCCTTTGGG ATGTAATGTC GAACGAAGAG GTCTGTGATG CTGCTCGCAA GAGGATATTA CTATGGCACA
AGAAGAATGC GGCCACCGCA TCAACGTCAT CGGCCCAAAT AAGCGGTGAT TCTTCAGATC CGGCTGCTCA AGCAGCTGCC
GACTACTTGT CCAAGCTTGC CCTACAGAAG GGGAGCAAGG ACAACATCAC TGTCGTTGTA ATTGACCTCA AGGCACATAG
GAAGTTCAAG AGCAAAGCAT GACATTGCCT CCATGAACAA TAACAATAGT TTATAGGAAG CTAGAAATGT GGGAAATCCA
AGACAATTTA TTTAGCTGCT GCACCGGTAC AATTTGTTTA GCTGCTGTTC AGTACTGGTG CTGCTGCAGC TGCAGCTGCT
TCTTTGCCCT CGCCATTTAT TTCTGCCGAG GGATGTACTA CTAGTATACT GTATTTTTCT ACACGGTACA GACTCCCAAA
TCTGATTCAG GGTCGAGGAC ATAAGGTGGA TCTGGGAATT TTGGGGTCTC TCAAGACAAG ACAGAAAACA TAACAAAATC
TGTAGATGTA GGTAGGAGTC CTAGGACAGA TTGGGTTTCT GCCTCTGGCA TTAATCGTTT TTGTTAACCG GTAAAGATAC
TGCTACTTGC AATTGCTGTT TCATATATAC TCC

Locus: Os05g0592800

Loading...

Locus: Os05g0592800

Loading...