Os05t0592800-03

Locus

Os05g0592800

Description

Similar to Protein phosphatase 2C ABI2 (EC 3.1.3.16) (PP2C) (Abscisic acid- insensitive 2).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPP2C53, PP2C53, OsPP81, OsABIL2, ABIL2

Oryzabase Gene Name Synonym(s)

protein phosphatase 2C53, protein phosphatase 2C 53, protein phosphatase 81, OsABI-LIKE2, ABI-LIKE2, ABI-LIKE 2

Transcript Evidence

AK104323 (DDBJ, Best hit)

Protein Evidence

NP_001150302.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein dephosphorylation (GO:0006470)

Cellular Component: protein serine/threonine phosphatase complex (GO:0008287)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein serine/threonine phosphatase activity (GO:0004722)

Functional domain (InterPro)

Protein phosphatase 2C, manganese/magnesium aspartate binding site (IPR000222)

Protein phosphatase 2C-like (IPR001932)

Protein phosphatase 2C (IPR015655)

Full-length cDNA

001-027-G08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0592800-03)

RiceXPro (AK104323)

Others

Oryzabase (17926)

KEGG (Os05t0592800-03 (EC:3.1.3.16))

Transcript

1916 bp

>Os05t0592800-03 Similar to Protein phosphatase 2C ABI2 (EC 3.1.3.16) (PP2C) (Abscisic acid- insensitive 2).
ACGCAACCCGATCCATTCCCAAATCCCTCCTCTCATCAACTCGACTCTCGGTCGGCGTCA
CCGGCGTCGGAGGCGGAGGCGGAGGCGGCGGCCGCGTCGGCAAGGTAGTGCTGTGCTGGA
TCGAGTCGAGCAGCTGGCTGCGCGCGCGGTTTGTGGCTCTCTGTGTGAGTCCGGCGCTGC
TGCTTCAATTCCTTCTTCCCCAGGGCACCTCCCGTGAGCCGCCATCTCCCTCCCTCACCT
ACCTCTGGATTCGCTCCAGATCCGCCCATGAGTAGGCCCCCACGCCCACCGCCTGCTCGC
CATCGCGCCTCCACTCCACCACACCATGCCGATCCCCACCACCTCTGACACTACTCCGCC
CCTCCCCCTCTCTCATTCCCATGGAGGACCTCGCCCTGCCCGCCGCTCCTCCTGCCCCCA
CGCTTAGCTTCACGCTCTTAGCCGCCGCCGCCGCCGTCGCCGAGGCCATGGAAGAGGCTC
TGGGCGCCGCGCTGCCGCCCCTCACCGCCCCCGTCCCCGCCCCCGGAGACGACTCCGCCT
GCGGGAGCCCGTGCTCCGTCGCCAGCGACTGCAGCAGCGTCGCCAGCGCCGACTTCGAGG
GCTTCGCCGAGCTAGGCACTTCGCTCCTCGCGGGGCCCGCCGTCTTGTTCGACGACCTCA
CCGCCGCCTCCGTCGCCGTCGCGGAGGCTGCCGAGCCGAGGGCTGTGGGGGCCACTGCGA
GGAGCGTGTTCGCCATGGACTGCGTTCCGCTCTGGGGGCTGGAGTCCATTTGCGGCCGCC
GCCCGGAGATGGAGGACGACTATGCCGTGGTCCCGCGATTTTTCGACCTTCCTCTGTGGA
TGGTTGCCGGCGACGCGGCAGTCGACGGCCTCGACCGGGCCTCCTTCCGCCTTCCAGCCC
ATTTCTTCGCCGTCTACGATGGCCACGGTGGCGTTCAGGTTGCCAATTACTGCAGGAAGA
GGATCCACGCCGTACTGACAGAGGAGCTGCGTAGAGCGGAGGACGACGCGTGTGGCTCTG
ACTTATCTGGCCTTGAGTCCAAGAAGCTGTGGGAGAAGGCGTTCGTGGATTGCTTCAGTC
GTGTTGACGCTGAGGTGGGAGGAAATGCTGCGTCTGGAGCACCGCCTGTTGCTCCAGACA
CCGTGGGGTCAACTGCTGTCGTCGCAGTCGTTTGCTCGTCACATGTCATCGTAGCCAACT
GCGGTGACTCGCGTGCTGTTCTCTGCCGGGGCAAGCAGCCCCTGCCCCTGTCACTAGATC
ATAAACCAAATAGGGAAGACGAGTACGCGAGGATTGAGGCGCTGGGTGGCAAGGTTATCC
AATGGAATGGTTATCGAGTTCTCGGTGTTCTTGCCATGTCGCGATCAATCGGGGACAAAT
ACCTGAAGCCATATATAATCCCGGTCCCTGAGGTCACAGTTGTCGCTCGTGCAAAAGACG
ATGATTGCCTTATTCTTGCAAGTGATGGCCTTTGGGATGTAATGTCGAACGAAGAGGTCT
GTGATGCTGCTCGCAAGAGGATATTACTATGGCACAAGAAGAATGCGGCCACCGCATCAA
CGTCATCGGCCCAAATAAGCGGTGATTCTTCAGATCCGGCTGCTCAAGCAGCTGCCGACT
ACTTGTCCAAGCTTGCCCTACAGAAGGGGAGCAAGGACAACATCACTGTCGTTGTAATTG
ACCTCAAGGCACATAGGAAGTTCAAGAGCAAAGCATGACATTGCCTCCATGAACAATAAC
AATAGTTTATAGGAAGCTAGAAATGTGGGAAATCCAAGACAATTTATTTAGCTGCTGCAC
CGGTACAATTTGTTTAGCTGCTGTTCAGTACTGGTGCTGCTGCAGCTGCAGCTGCTTCTT
TGCCCTCGCCATTTATTTCTGCCGAGGGATGTACTACTAGTATACTGTATTTTTCT

CDS

1338 bp

>Os05t0592800-03 Similar to Protein phosphatase 2C ABI2 (EC 3.1.3.16) (PP2C) (Abscisic acid- insensitive 2).
ATGGAGGACCTCGCCCTGCCCGCCGCTCCTCCTGCCCCCACGCTTAGCTTCACGCTCTTA
GCCGCCGCCGCCGCCGTCGCCGAGGCCATGGAAGAGGCTCTGGGCGCCGCGCTGCCGCCC
CTCACCGCCCCCGTCCCCGCCCCCGGAGACGACTCCGCCTGCGGGAGCCCGTGCTCCGTC
GCCAGCGACTGCAGCAGCGTCGCCAGCGCCGACTTCGAGGGCTTCGCCGAGCTAGGCACT
TCGCTCCTCGCGGGGCCCGCCGTCTTGTTCGACGACCTCACCGCCGCCTCCGTCGCCGTC
GCGGAGGCTGCCGAGCCGAGGGCTGTGGGGGCCACTGCGAGGAGCGTGTTCGCCATGGAC
TGCGTTCCGCTCTGGGGGCTGGAGTCCATTTGCGGCCGCCGCCCGGAGATGGAGGACGAC
TATGCCGTGGTCCCGCGATTTTTCGACCTTCCTCTGTGGATGGTTGCCGGCGACGCGGCA
GTCGACGGCCTCGACCGGGCCTCCTTCCGCCTTCCAGCCCATTTCTTCGCCGTCTACGAT
GGCCACGGTGGCGTTCAGGTTGCCAATTACTGCAGGAAGAGGATCCACGCCGTACTGACA
GAGGAGCTGCGTAGAGCGGAGGACGACGCGTGTGGCTCTGACTTATCTGGCCTTGAGTCC
AAGAAGCTGTGGGAGAAGGCGTTCGTGGATTGCTTCAGTCGTGTTGACGCTGAGGTGGGA
GGAAATGCTGCGTCTGGAGCACCGCCTGTTGCTCCAGACACCGTGGGGTCAACTGCTGTC
GTCGCAGTCGTTTGCTCGTCACATGTCATCGTAGCCAACTGCGGTGACTCGCGTGCTGTT
CTCTGCCGGGGCAAGCAGCCCCTGCCCCTGTCACTAGATCATAAACCAAATAGGGAAGAC
GAGTACGCGAGGATTGAGGCGCTGGGTGGCAAGGTTATCCAATGGAATGGTTATCGAGTT
CTCGGTGTTCTTGCCATGTCGCGATCAATCGGGGACAAATACCTGAAGCCATATATAATC
CCGGTCCCTGAGGTCACAGTTGTCGCTCGTGCAAAAGACGATGATTGCCTTATTCTTGCA
AGTGATGGCCTTTGGGATGTAATGTCGAACGAAGAGGTCTGTGATGCTGCTCGCAAGAGG
ATATTACTATGGCACAAGAAGAATGCGGCCACCGCATCAACGTCATCGGCCCAAATAAGC
GGTGATTCTTCAGATCCGGCTGCTCAAGCAGCTGCCGACTACTTGTCCAAGCTTGCCCTA
CAGAAGGGGAGCAAGGACAACATCACTGTCGTTGTAATTGACCTCAAGGCACATAGGAAG
TTCAAGAGCAAAGCATGA

Protein

445 aa

>Os05t0592800-03 Similar to Protein phosphatase 2C ABI2 (EC 3.1.3.16) (PP2C) (Abscisic acid- insensitive 2).
MEDLALPAAPPAPTLSFTLLAAAAAVAEAMEEALGAALPPLTAPVPAPGDDSACGSPCSV
ASDCSSVASADFEGFAELGTSLLAGPAVLFDDLTAASVAVAEAAEPRAVGATARSVFAMD
CVPLWGLESICGRRPEMEDDYAVVPRFFDLPLWMVAGDAAVDGLDRASFRLPAHFFAVYD
GHGGVQVANYCRKRIHAVLTEELRRAEDDACGSDLSGLESKKLWEKAFVDCFSRVDAEVG
GNAASGAPPVAPDTVGSTAVVAVVCSSHVIVANCGDSRAVLCRGKQPLPLSLDHKPNRED
EYARIEALGGKVIQWNGYRVLGVLAMSRSIGDKYLKPYIIPVPEVTVVARAKDDDCLILA
SDGLWDVMSNEEVCDAARKRILLWHKKNAATASTSSAQISGDSSDPAAQAAADYLSKLAL
QKGSKDNITVVVIDLKAHRKFKSKA*

5'UTR

chr05:29541597..29541976 (- strand) : 380 bp

CDS

chr05:29541039..29541596 (- strand) : 558 bp

chr05:29540612..29540938 (- strand) : 327 bp

chr05:29540409..29540514 (- strand) : 106 bp

chr05:29538874..29539220 (- strand) : 347 bp

3'UTR

chr05:29538676..29538873 (- strand) : 198 bp

FASTA

>Os05t0592800-03 class=Sequence position=chr05:29538676..29541976 (- strand)
ACGCAACCCG ATCCATTCCC AAATCCCTCC TCTCATCAAC TCGACTCTCG GTCGGCGTCA CCGGCGTCGG AGGCGGAGGC
GGAGGCGGCG GCCGCGTCGG CAAGGTAGTG CTGTGCTGGA TCGAGTCGAG CAGCTGGCTG CGCGCGCGGT TTGTGGCTCT
CTGTGTGAGT CCGGCGCTGC TGCTTCAATT CCTTCTTCCC CAGGGCACCT CCCGTGAGCC GCCATCTCCC TCCCTCACCT
ACCTCTGGAT TCGCTCCAGA TCCGCCCATG AGTAGGCCCC CACGCCCACC GCCTGCTCGC CATCGCGCCT CCACTCCACC
ACACCATGCC GATCCCCACC ACCTCTGACA CTACTCCGCC CCTCCCCCTC TCTCATTCCC ATGGAGGACC TCGCCCTGCC
CGCCGCTCCT CCTGCCCCCA CGCTTAGCTT CACGCTCTTA GCCGCCGCCG CCGCCGTCGC CGAGGCCATG GAAGAGGCTC
TGGGCGCCGC GCTGCCGCCC CTCACCGCCC CCGTCCCCGC CCCCGGAGAC GACTCCGCCT GCGGGAGCCC GTGCTCCGTC
GCCAGCGACT GCAGCAGCGT CGCCAGCGCC GACTTCGAGG GCTTCGCCGA GCTAGGCACT TCGCTCCTCG CGGGGCCCGC
CGTCTTGTTC GACGACCTCA CCGCCGCCTC CGTCGCCGTC GCGGAGGCTG CCGAGCCGAG GGCTGTGGGG GCCACTGCGA
GGAGCGTGTT CGCCATGGAC TGCGTTCCGC TCTGGGGGCT GGAGTCCATT TGCGGCCGCC GCCCGGAGAT GGAGGACGAC
TATGCCGTGG TCCCGCGATT TTTCGACCTT CCTCTGTGGA TGGTTGCCGG CGACGCGGCA GTCGACGGCC TCGACCGGGC
CTCCTTCCGC CTTCCAGCCC ATTTCTTCGC CGTCTACGAT GGCCACGGTG GCGTTCAGGT TCCCTTTGCT TTTGTTTTTG
CCTCATCACA GTCACAGCAC ATTAAACGAA TCCAACACAC CGATGATAAC CTTTTCTCCA TGCTCTCATC TGTTGCAGGT
TGCCAATTAC TGCAGGAAGA GGATCCACGC CGTACTGACA GAGGAGCTGC GTAGAGCGGA GGACGACGCG TGTGGCTCTG
ACTTATCTGG CCTTGAGTCC AAGAAGCTGT GGGAGAAGGC GTTCGTGGAT TGCTTCAGTC GTGTTGACGC TGAGGTGGGA
GGAAATGCTG CGTCTGGAGC ACCGCCTGTT GCTCCAGACA CCGTGGGGTC AACTGCTGTC GTCGCAGTCG TTTGCTCGTC
ACATGTCATC GTAGCCAACT GCGGTGACTC GCGTGCTGTT CTCTGCCGGG GCAAGCAGCC CCTGCCCCTG TCACTAGATC
ATAAAGTAAG CCATGGACTC CCATTGATTC CATGTATGAG TAATTGACTC GAGTCCTGAG GATAATTGGA TACGAATTGC
CTTGTTCTTC TTCGTGCTTC AGCCAAATAG GGAAGACGAG TACGCGAGGA TTGAGGCGCT GGGTGGCAAG GTTATCCAAT
GGAATGGTTA TCGAGTTCTC GGTGTTCTTG CCATGTCGCG ATCAATCGGT ATGCATTCTC ACCCTTTTGA CATAATTGAA
CCAGTGTTTG TTTGTGCTTC ATTGTTTATG CTTCTCCAAC TTTACTGATG TGACTGTGCT GATGATAGCT GATTGGGTAA
TTGATGTGTC AAAGGAAAAG TCTCTTGACT GGTTCATTTT GTTATTTTGT TCTGAATTGT GATGATATAT GGTGCTCTAG
GGTTTGTGAC TTTTCTAAGT GAAAAATCAC TGGCTGATTG TTGCTCCCTG GTGTAATGAC ATTGTACCCC CAAGTTTATT
TACAAATACC TTGCATCAAT GCGATTGTTT GCAACTGGTA GTGAGTTTGT ACCTATGGTG GCAGAGAGAG CTCCTCGGCT
AATTACTTTG TTAGTTTGTT CCTAGTCATA CTGTTAAGTG ATTTGCGATG CTATGATTCA GGCATATATT TCTATATTTG
TTAGCTATGT TGCCATATGC GATACTGGTA TAGGCGTTTG GTGAGTATAC ATGCAGTTCA CAATAGGAAA ATATAAGAGA
ATATGAGAGA CTTAGACATT GAGATCACCT TGATGGAAAA ATATTAAGAG TAATACTAAA TGGCAGAATA CTTCAAAGTA
GTGATTTCTG TCATACCAAA CACTAGGATG AGTCACTAAC TACACGACAG CTGTATAAGC CATTGTTTGC ATTCATTGTG
ATCAAGGAAC AGCTGTACTA TATCGAGGAT TGTAAGGACT GATGTAATAA TGTGCCATTG TGCATCAATT GAGCTTTGGA
TGTTAGCTTC ACACCTTCAC CCATGTTGCT GCACAGCAGT CAATCATATT TGTTAATTTA CTGTTGCAGT CAGATGAGGT
TTCTTCCCAT TGAATCTTAA GGGAGAAAGC CTGGCCCAAT ATATATCACA AGACTTGAAT AACTCTTTCA TCAGCATTTA
CTCTGATTCG CTTTTGCTGT ATTGATGCTT CAAACTAGAG AGAGAATCAT AACATCATGC TATTCTTCTG TTGTACCCCG
GTTTATTAGT TCCAGTGTTC ATGTATCCTG TCAGTTTTTG TTGCTCTTAA CATGTTATTC TGTGACTGGT AATTTGATTT
CAATGTCTTT AATATATGGC TTTTGTTGAT ACTTCAAAGT TCAAAGTAGA TAAATTATGT TTGATTTATT GGTGCGCTTG
CCAATACTTC TGGTCTGTGC ATTGATGTAT TTGCAGGGGA CAAATACCTG AAGCCATATA TAATCCCGGT CCCTGAGGTC
ACAGTTGTCG CTCGTGCAAA AGACGATGAT TGCCTTATTC TTGCAAGTGA TGGCCTTTGG GATGTAATGT CGAACGAAGA
GGTCTGTGAT GCTGCTCGCA AGAGGATATT ACTATGGCAC AAGAAGAATG CGGCCACCGC ATCAACGTCA TCGGCCCAAA
TAAGCGGTGA TTCTTCAGAT CCGGCTGCTC AAGCAGCTGC CGACTACTTG TCCAAGCTTG CCCTACAGAA GGGGAGCAAG
GACAACATCA CTGTCGTTGT AATTGACCTC AAGGCACATA GGAAGTTCAA GAGCAAAGCA TGACATTGCC TCCATGAACA
ATAACAATAG TTTATAGGAA GCTAGAAATG TGGGAAATCC AAGACAATTT ATTTAGCTGC TGCACCGGTA CAATTTGTTT
AGCTGCTGTT CAGTACTGGT GCTGCTGCAG CTGCAGCTGC TTCTTTGCCC TCGCCATTTA TTTCTGCCGA GGGATGTACT
ACTAGTATAC TGTATTTTTC T

Locus: Os05g0592800

Loading...

Locus: Os05g0592800

Loading...