Os05t0594200-01

Locus

Os05g0594200

Description

Similar to Cation/proton exchanger 1a.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAX1B

CGSNL Gene Name

Ca(2+)/H(+) EXCHANGER 1B

Oryzabase Gene Symbol Synonym(s)

OsCAX1b, CAX1b, CAX3, OsNCX10, NCX10

Oryzabase Gene Name Synonym(s)

Vacuolar cation/proton exchanger 1b, Ca(2+)/H(+) exchanger 1b, cation/H+ exchanger 1b, Na+/Ca2+ Exchanger 10, Sodium/calcium exchanger 10

Transcript Evidence

AK069021 (DDBJ, Best hit)

Protein Evidence

Q5TKG3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cation transport (GO:0006812)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: cation transmembrane transporter activity (GO:0008324)

Functional domain (InterPro)

Calcium/proton exchanger (IPR004713)

Calcium/proton exchanger superfamily (IPR004798)

Sodium/calcium exchanger membrane region (IPR004837)

Full-length cDNA

J013170B16 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0594200-01)

RiceXPro (AK069021)

Others

Oryzabase (8980)

KEGG (Os05t0594200-01)

Transcript

2366 bp

>Os05t0594200-01 Similar to Cation/proton exchanger 1a.
GGATTGGTTTCTTTCTGCTCTGTTGCAGCTCCGTTGTCTATGGTAGGTACCTTTTGGACG
GAGGTTTTGCATTTGCCTAGTTACTAGTAACTGCATAATTAACAGGAGGAGTACTACCAA
GAATGCATACTAATTATTCGCGTGATATTTTGTACGTTTAAGTTTAGAGAACCCGGGATT
CGACCAGACCATCAGTCCACTCTCTCTCTCTCTCTGCTTCTTCTTGTGTTGTGCTTGTGC
CTCCTCATTATTAATATCTGTACTCCATATTCTACTACTGCATGCTGGAGTACTCTGGTC
ATGGAGCATTTGACATTTGCATCCACCCCGATGAGCTGAGCTGCTCCATTAATATACTAT
TCCTCCTCAATTAGTCATTCACTACATACATACAGCAAAATCCTAGCACCACGACGGCGG
CCGCATTTGTATGAAATCGATAGATCGTCTCTCTCTCTCTCTCATCCAACCAACCACGCA
CAGCGACTCAGCGAGCGAGGAACAACTAGAGCTTGATGCCAGTGTCGCGGATGATGATGG
AGTCGAATACGATGGCCAAGGAGATGGCCGTGCGGCACCACCTCCTTCCGGGGTCTCCTC
GCCGCCGCACCGCACACAACCTCTCATCTTCCTCCCTCCGCAAAAGCTCCGACGCCTCCC
TCCTCCACAAGGTTCCCTGCgccgccctccgctccctcctcgccaatctcaacgacgtcc
tcctcaccaccaggctcttcctcctcttccccgccgtcctcctcgccatcgccgccactt
acctccacttcggacagGTGTGGGTGTTTGTGCTTAGCTTAATCGGCCTCGTTCCTCTTG
CTGAGCGACTCAGCTTCCTCACCGAGCAGATTGCATTTTACACCGGTCCTACTGTGGGAG
GACTACTGAACGCGACATTTGGGAACGTGACGGAGGTGATAATCGCGCTGTTGGCGCTGC
GAGAAGGAAAGATTGAGGTGGTGAAATGCTCCCTGCTGGGATCCATCCTCTCCAACCTGC
TGCTTGTCCTCGGCACCTCCCTCTTCCTCGCCGGCATCGCCAACCTCCGCGCCCACCAGC
CGTACGACACCAAGCAAGCTCACGTCAACACCGCCCTCCTCATGCTCGCCGTCCTCTGCC
ACTCCCTGCCGCTCATGCTCAGGTACGCCGTCACCTCCGGCGACCACGCCATCGTCTCCG
GCGACGCCGCCCTCCACCTGTCGCGTGCCTGCAGCATCCTCATGCTCATCGCCTACCTGG
CCTACCTCTTCTTCCAACTCAACACGCATCGCCAGCTGTTTGAGCCCCAACAGGTTGAGG
ATGATGACGACGATGATTTAGTGATCGCTCAAGATGATGAGCCAGTACTGGGATTCTCGA
GTGCCATGATTTGGCTGGCTCTCATGACTCTCCTGACTGCGCTCTTGTCAGGGTATGTTG
TGAGCACAATTGAGgcggcctcagaatcatgggaactatcagtgagcttcattagcatca
tcttgcttcccatcgttgggaacgcagcagagcatgccggtgccgtcatatttgctctca
agaacaagatggatattactctcggagtgtctttgggctctgccacacagatctccatgt
ttgtgGTTCCAGTGAGTGTGATTGTAGCCTGGACTATGGGAATCCCAATGGATCTTGATT
TCAACCTGCTGGAGACTGGCTCTCTGTTTCTAGCAATATTAGTGACAGCCTTCACCCTCC
AGGAGGGAGAATCACATTATCTGAAGGGATTGATTCTTGTCCTGTGCTACGCTGTCATCA
GCGTGTGCTTTTTCGTTATAAGACGGCGTTCTGCAGGAGGGACGGACGGTGTTCACCATC
TGGATGTGATTGTGTAGCAAATTACTAACAGGCAGACCGCAGAAGCAGAAACGTACGTAC
ATGCGCCTAACATATATATGGAGTCCGTACAGTACGTGCTAGCTACGGAGTACTCCTGTA
CACTACTGTACTACTGCTTGCACAAGAGAAGAGGATCGAGTACCGTAGCTAGCACAGGCG
GCGGAGACGAGACGATCTGCTTGCTTGAGGAGGCAGCCGATCGAAGCCGGACTGGGCGGA
GATCGATGCATGGATCCAGTTTGTTTAGACTGACGGACGATAGAGGATGATACCACGACC
CAACCATCCGTCCCTGCAATTGGCTGGTTTGGTCATTCAAATAGGGAATCACAATTGGGT
TTTAATGGGTTGCTTTAGTTTAGGTCGTTTTGGAATGGTTTGTTTATATTTATCTTTTTC
AAAGGAGTTTGTTTAGGTTTATCGAACTACTAGAATATACATCCATCTTAAGATTATTAC
ATTTTAAAATAAAGATATATAGTATG

CDS

1362 bp

>Os05t0594200-01 Similar to Cation/proton exchanger 1a.
ATGCCAGTGTCGCGGATGATGATGGAGTCGAATACGATGGCCAAGGAGATGGCCGTGCGG
CACCACCTCCTTCCGGGGTCTCCTCGCCGCCGCACCGCACACAACCTCTCATCTTCCTCC
CTCCGCAAAAGCTCCGACGCCTCCCTCCTCCACAAGGTTCCCTGCgccgccctccgctcc
ctcctcgccaatctcaacgacgtcctcctcaccaccaggctcttcctcctcttccccgcc
gtcctcctcgccatcgccgccacttacctccacttcggacagGTGTGGGTGTTTGTGCTT
AGCTTAATCGGCCTCGTTCCTCTTGCTGAGCGACTCAGCTTCCTCACCGAGCAGATTGCA
TTTTACACCGGTCCTACTGTGGGAGGACTACTGAACGCGACATTTGGGAACGTGACGGAG
GTGATAATCGCGCTGTTGGCGCTGCGAGAAGGAAAGATTGAGGTGGTGAAATGCTCCCTG
CTGGGATCCATCCTCTCCAACCTGCTGCTTGTCCTCGGCACCTCCCTCTTCCTCGCCGGC
ATCGCCAACCTCCGCGCCCACCAGCCGTACGACACCAAGCAAGCTCACGTCAACACCGCC
CTCCTCATGCTCGCCGTCCTCTGCCACTCCCTGCCGCTCATGCTCAGGTACGCCGTCACC
TCCGGCGACCACGCCATCGTCTCCGGCGACGCCGCCCTCCACCTGTCGCGTGCCTGCAGC
ATCCTCATGCTCATCGCCTACCTGGCCTACCTCTTCTTCCAACTCAACACGCATCGCCAG
CTGTTTGAGCCCCAACAGGTTGAGGATGATGACGACGATGATTTAGTGATCGCTCAAGAT
GATGAGCCAGTACTGGGATTCTCGAGTGCCATGATTTGGCTGGCTCTCATGACTCTCCTG
ACTGCGCTCTTGTCAGGGTATGTTGTGAGCACAATTGAGgcggcctcagaatcatgggaa
ctatcagtgagcttcattagcatcatcttgcttcccatcgttgggaacgcagcagagcat
gccggtgccgtcatatttgctctcaagaacaagatggatattactctcggagtgtctttg
ggctctgccacacagatctccatgtttgtgGTTCCAGTGAGTGTGATTGTAGCCTGGACT
ATGGGAATCCCAATGGATCTTGATTTCAACCTGCTGGAGACTGGCTCTCTGTTTCTAGCA
ATATTAGTGACAGCCTTCACCCTCCAGGAGGGAGAATCACATTATCTGAAGGGATTGATT
CTTGTCCTGTGCTACGCTGTCATCAGCGTGTGCTTTTTCGTTATAAGACGGCGTTCTGCA
GGAGGGACGGACGGTGTTCACCATCTGGATGTGATTGTGTAG

Protein

454 aa

>Os05t0594200-01 Similar to Cation/proton exchanger 1a.
MPVSRMMMESNTMAKEMAVRHHLLPGSPRRRTAHNLSSSSLRKSSDASLLHKVPCAALRS
LLANLNDVLLTTRLFLLFPAVLLAIAATYLHFGQVWVFVLSLIGLVPLAERLSFLTEQIA
FYTGPTVGGLLNATFGNVTEVIIALLALREGKIEVVKCSLLGSILSNLLLVLGTSLFLAG
IANLRAHQPYDTKQAHVNTALLMLAVLCHSLPLMLRYAVTSGDHAIVSGDAALHLSRACS
ILMLIAYLAYLFFQLNTHRQLFEPQQVEDDDDDDLVIAQDDEPVLGFSSAMIWLALMTLL
TALLSGYVVSTIEAASESWELSVSFISIILLPIVGNAAEHAGAVIFALKNKMDITLGVSL
GSATQISMFVVPVSVIVAWTMGIPMDLDFNLLETGSLFLAILVTAFTLQEGESHYLKGLI
LVLCYAVISVCFFVIRRRSAGGTDGVHHLDVIV*

5'UTR

chr05:29593325..29593839 (- strand) : 515 bp

CDS

chr05:29593043..29593324 (- strand) : 282 bp

chr05:29591612..29591679 (- strand) : 68 bp

chr05:29591231..29591259 (- strand) : 29 bp

chr05:29590727..29591145 (- strand) : 419 bp

chr05:29590495..29590635 (- strand) : 141 bp

chr05:29590235..29590351 (- strand) : 117 bp

chr05:29590076..29590129 (- strand) : 54 bp

chr05:29589556..29589672 (- strand) : 117 bp

chr05:29589336..29589429 (- strand) : 94 bp

chr05:29589148..29589188 (- strand) : 41 bp

3'UTR

chr05:29588659..29589147 (- strand) : 489 bp

FASTA

>Os05t0594200-01 class=Sequence position=chr05:29588659..29593839 (- strand)
GGATTGGTTT CTTTCTGCTC TGTTGCAGCT CCGTTGTCTA TGGTAGGTAC CTTTTGGACG GAGGTTTTGC ATTTGCCTAG
TTACTAGTAA CTGCATAATT AACAGGAGGA GTACTACCAA GAATGCATAC TAATTATTCG CGTGATATTT TGTACGTTTA
AGTTTAGAGA ACCCGGGATT CGACCAGACC ATCAGTCCAC TCTCTCTCTC TCTCTGCTTC TTCTTGTGTT GTGCTTGTGC
CTCCTCATTA TTAATATCTG TACTCCATAT TCTACTACTG CATGCTGGAG TACTCTGGTC ATGGAGCATT TGACATTTGC
ATCCACCCCG ATGAGCTGAG CTGCTCCATT AATATACTAT TCCTCCTCAA TTAGTCATTC ACTACATACA TACAGCAAAA
TCCTAGCACC ACGACGGCGG CCGCATTTGT ATGAAATCGA TAGATCGTCT CTCTCTCTCT CTCATCCAAC CAACCACGCA
CAGCGACTCA GCGAGCGAGG AACAACTAGA GCTTGATGCC AGTGTCGCGG ATGATGATGG AGTCGAATAC GATGGCCAAG
GAGATGGCCG TGCGGCACCA CCTCCTTCCG GGGTCTCCTC GCCGCCGCAC CGCACACAAC CTCTCATCTT CCTCCCTCCG
CAAAAGCTCC GACGCCTCCC TCCTCCACAA GGTTCCCTGC gccgccctcc gctccctcct cgccaatctc aacgacgtcc
tcctcaccac caggctcttc ctcctcttcc ccgccgtcct cctcgccatc gccgccactt acctccactt cggacaggta
ccctcctcat ccATCTCTCT CCAATTTACG TTGCTCGTCC ATTCTTATGA CAAGCCACAA GCATGCTCAT ATCAATACTA
GTACTAGGCA AGGAACTGTG GTCGATAATC CCAGCCCTTT TTTTttttta cggatgcgca aaagaattac acgtcaatat
attagaagaa aaaagtataa ttacacaaca caatcagcca gaccggctta tactagagta agagagaaaa aacaaaataa
aaagctaaag cttaaaaaaa ctACGGGGCT AAACACAAAA AAACTCCAAT TGTTGGCCAA GCCCTATAAT CCCTACCCAT
GGCGCCCATC GTATCGTTAG GCAGTGAAGG TCGTGAGTCT TAGCTCTTGA ACATTTATGT TACCGCAAGA TAAACTGCAT
TTGTCTCATG GGTTTCAACG ATGTTTGGTT TGTTCGTTAG ATTCGAGATA AGAAAGATGT GAGTAGTGCG TACTGTGTCG
CTGAGAAATA TGTTTGGGGC CATGTTCATC AAGAGATGCA CTAAATTACG TCAAACCAAA GTAAATTAGG AGGGTATTTT
AAACTTAGCA TAACAGGTTT TTTTTTATAA TTTTCCAAAA AAAAAAAACA CTCCACCAAC AACACATGAC GAATACAAGA
TCGAGCCGGA TGATGGCGAT TAGATTAATT TGTACTAGCT GAGTGCATGT GCTCGCGCAT GTGGTGAAGT TGCCTGCAGC
CTGTGAAACC CTATTAAAAT ACAAACAGAT GGAATCATGG AATTGCAACA ATTAAGCAAG TTGACACTTG ACACACCCAT
CACATGCATG GCCAGGCTAA TATTAATCCC CCTCCTCACG GTCACGGATT TTTCGTCGTC GCATCTCAGC CATATGGCAA
CGGTGCGTCC TAGATACACT CCACTAGTAC TGTACTAACC AAAAACTACT GTAACATCCC TAAGCTAAAg gcctgtttag
atccctgtga aatttttcac cctgtcacat caaatgtttg gacatataca tgaagtatta atataaaaaa aataactaat
tacacagatt gtgtgtaaat tacgagacaa atcttttaag cctaattatt tcatgatttg acaatgtgat gctacagtaa
acatttacta atgatagatt aattaggcta ataaatttat ctcacagttt acatgcggaa tctgtcattt gttgttttgt
tattagtcta cgtttaatac ttcaaatatg tgttcgtata tccgatacgc caaaactttt cacctctaga tctaaacacA
ACCTAAGTAC AAACTAAATA ATCAACCATT CAAAAAAAAA ACTAAATGAT CAACCAGCTT TCTTACAGTA TTAATTGCAG
GTGTGGGTGT TTGTGCTTAG CTTAATCGGC CTCGTTCCTC TTGCTGAGCG ACTCAGCTTC CTCACCGAGT AAGCTCCCTT
AACTAATTCC TACCATGCTC AGATAATGTA CATCATGCAT GCATGCAACC ATATactctt ctgatcataa gtcgttctga
tttttttcta aattaatctt ctttagtttt aattaacttt ataataatat ttttaacata aaacaagaaa aaatataaaa
tatattgaat gttagtttta ataaaattaa tttaatgctg taaatattaa tatatttttt tataaacttg atcgaacttt
tagaaaagtc aaagtgactt ataagtataa aTGGGGGAGA GTAATTATAA TAGTGATCTT GAATTTTGTG ACAATTAATT
GGTTGCGTGT ATGCATGCAG GCAGATTGCA TTTTACACCG GTCCTACTGG TAAGTGAATT CCATGCATGC TAGCTATTCG
TTTCGATCAG GATCAAGTGG AAATGCATCA AGTGAAGTGC ATGCATGGTT GCAGTGGGAG GACTACTGAA CGCGACATTT
GGGAACGTGA CGGAGGTGAT AATCGCGCTG TTGGCGCTGC GAGAAGGAAA GATTGAGGTG GTGAAATGCT CCCTGCTGGG
ATCCATCCTC TCCAACCTGC TGCTTGTCCT CGGCACCTCC CTCTTCCTCG CCGGCATCGC CAACCTCCGC GCCCACCAGC
CGTACGACAC CAAGCAAGCT CACGTCAACA CCGCCCTCCT CATGCTCGCC GTCCTCTGCC ACTCCCTGCC GCTCATGCTC
AGGTACGCCG TCACCTCCGG CGACCACGCC ATCGTCTCCG GCGACGCCGC CCTCCACCTG TCGCGTGCCT GCAGCATCCT
CATGCTCATC GCCTACCTGG CCTACCTCTT CTTCCAACTC AACACGCATC GCCAGCTGTT TGAGCCCCAA CAGGTACGTC
CCGTCTGTGA TTGATCGATG CATGTCCTGT ACTACGTTCG ATCCCACCAA CACCAAATGG TAATTATTAT ATTTTTCTAA
TTAGGTTGAG GATGATGACG ACGATGATTT AGTGATCGCT CAAGATGATG AGCCAGTACT GGGATTCTCG AGTGCCATGA
TTTGGCTGGC TCTCATGACT CTCCTGACTG CGCTCTTGTC AGGGTATGTT GTGAGCACAA TTGAGGTACA GTATATATAT
ATATCATCCT AGTACCATTT ACATATATGC TGCTGTACTG TACTGTATTA ATCTTCAGTG AATTGGCAAG ATGCATGCAT
AATGAAGCTA GCTAAACCAC CTTTTGTACG TATCTTGTGA ATGTAcaggc ggcctcagaa tcatgggaac tatcagtgag
cttcattagc atcatcttgc ttcccatcgt tgggaacgca gcagagcatg ccggtgccgt catatttgct ctcaagaaca
agatggtact ccatataatt aagcagcaca cacatacagt atatatatat atatatgcag cagagtattg gtctttctta
tcattaattt gttgtgactt gtgacgacag gatattactc tcggagtgtc tttgggctct gccacacaga tctccatgtt
tgtggtaTGT AGGAGTAGCT AGTACGTAGT ACTAGTAATT TACTAACCTC GCTCTATACA TTGATActct ctccattcca
taatataaga cacaaccact tttttttaca tgttccataa tgtaagacat acatacacat gcatgccatt aactatgaca
attctccatt aaattactat tttttttaaa atccttcact ctcacattct ctaactctat tggatacatg cattacattt
attaggatga tccaaactac aaggtgataa taactatttc ttggtctttg ggttaagggt ggttgtgtct tatattttgg
aatggaggga ATAGTTATTA GTGGAGTATG TATGTAGACA TGCGTGTTAG TATGTTGTTG TGATGGAAGT GATGAACTGT
GCGGCAGGTT CCAGTGAGTG TGATTGTAGC CTGGACTATG GGAATCCCAA TGGATCTTGA TTTCAACCTG CTGGAGACTG
GCTCTCTGTT TCTAGCAATA TTAGTGACAG CCTTCACCCT CCAGGTAAGT ACTAGCTAGT AAAAGCTGAA ATTATTGGTT
CGATCTTGTT CAGAATCAAA GTGAAATACA GTAGTACAGT AAAACTCTTA AGATTGTCGG TATTTTATTA GAAGTATATA
TATGTTTCAG GAGGGAGAAT CACATTATCT GAAGGGATTG ATTCTTGTCC TGTGCTACGC TGTCATCAGC GTGTGCTTTT
TCGTTATAAG ACGGCGTTCT GCAGGTATAT GTTATGTTAT GTACTTTCTA CTACAGTATG TAGGAAGCAC TACTAGACAG
TAGAGTAGAG TAGTAATTTG GCATTTGATA GTGTGGTCGA TCGCCGGCCG ACTGATCATA TATATACGTG TGCGTGTGTG
TGTGTGTGTA GGAGGGACGG ACGGTGTTCA CCATCTGGAT GTGATTGTGT AGCAAATTAC TAACAGGCAG ACCGCAGAAG
CAGAAACGTA CGTACATGCG CCTAACATAT ATATGGAGTC CGTACAGTAC GTGCTAGCTA CGGAGTACTC CTGTACACTA
CTGTACTACT GCTTGCACAA GAGAAGAGGA TCGAGTACCG TAGCTAGCAC AGGCGGCGGA GACGAGACGA TCTGCTTGCT
TGAGGAGGCA GCCGATCGAA GCCGGACTGG GCGGAGATCG ATGCATGGAT CCAGTTTGTT TAGACTGACG GACGATAGAG
GATGATACCA CGACCCAACC ATCCGTCCCT GCAATTGGCT GGTTTGGTCA TTCAAATAGG GAATCACAAT TGGGTTTTAA
TGGGTTGCTT TAGTTTAGGT CGTTTTGGAA TGGTTTGTTT ATATTTATCT TTTTCAAAGG AGTTTGTTTA GGTTTATCGA
ACTACTAGAA TATACATCCA TCTTAAGATT ATTACATTTT AAAATAAAGA TATATAGTAT G

Locus: Os05g0594200

Loading...

Locus: Os05g0594200

Loading...