Os05t0595100-01

Locus

Os05g0595100

Description

Uridine-diphospho-(UDP)-glucose 4-epimerase, Cell wall carbohydrate partitioning during nitrogen (N) limitation

RAP-DB Gene Symbol Synonym(s)

OsUGE1, OsUGE-1, UGE1, UGE-1

RAP-DB Gene Name Synonym(s)

UDP-glucose epimerase 1, UDP-glucose 4-epimerase 1

CGSNL Gene Symbol

UGE1

CGSNL Gene Name

UDP-GLUCOSE EPIMERASE 1

Oryzabase Gene Symbol Synonym(s)

OsUGE1, OsUGE-1, UGE-1

Oryzabase Gene Name Synonym(s)

UDP-glucose epimerase 1, UDP-glucose 4-epimerase 1

Transcript Evidence

AB087745

Protein Evidence

Q8LNZ3

Literature

PMID: 24788752

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

June 9, 2016

Gene Ontology (GO)

Biological Process: galactose metabolic process (GO:0006012)

Molecular Function: UDP-glucose 4-epimerase activity (GO:0003978)

Functional domain (InterPro)

UDP-glucose 4-epimerase GalE (IPR005886)

NAD(P)-binding domain (IPR016040)

Expression Databases

TENOR (Os05t0595100-01)

Others

Oryzabase (12410)

Transcript

1346 bp

>Os05t0595100-01 Uridine-diphospho-(UDP)-glucose 4-epimerase, Cell wall carbohydrate partitioning during nitrogen (N) limitation
CTTCCGCTCTCTAGCTTTGCTTTGCTTGCTTCATCAAACCCCACACACGCACACAACAAC
AACAAGAGTAATCAAAGTAGAAGAAGATGGTTTCGGCCTTGTTGCGGACGATCCTGGTGA
CGGGCGGCGCCGGCTACATCGGCAGCCACACCGTCCTCCAGCTTCTCCAACTCGGCTTCC
GCGTTGTCGTCCTCGACAACCTCGACAACGCCTCCGAGCTCGCCATCCTCCGCGTCAGGG
AACTCGCCGGACACAACGCCAACAACCTCGACTTCCGCAAGGTTGACCTCCGCGACAAGC
AAGCGTTGGACCAAATCTTCTCCTCTCAAAGGTTTGAGGCTGTCATCCATTTTGCCGGGC
TGAAAGCTGTTGGCGAGAGCGTGCAGAAGCCCCTGCTTTACTACGACAACAACCTCATCG
GCACCATCACTCTCCTGCAGGTCATGGCCGCACATGGCTGCACCAAGCTGGTGTTCTCAT
CATCCGCAACTGTCTACGGGTGGCCCAAGGAGGTGCCCTGCACTGAAGAATCCCCACTTT
GTGCAATGAACCCCTACGGCAGAACAAAGCTGGTAATCGAAGACATGTGCCGGGATCTGC
ATGCCTCAGACCCAAACTGGAAGATCATACTGCTCCGATACTTCAACCCTGTTGGAGCTC
ACCCAAGCGGGTACATTGGTGAGGACCCCTGCGGCATCCCAAACAACCTCATGCCCTTCG
TCCAGCAGGTCGCTGTTGGCAGGAGGCCGGCCCTTACCGTCTATGGAACCGACTACAACA
CCAAGGATGGAACTGGGGTTCGTGACTATATCCATGTTGTTGATCTAGCGGATGGTCATA
TCGCCGCGTTAAGGAAGCTCTATGAAGATTCTGATAGAATAGGATGTGAGGTGTACAATC
TGGGCACTGGAAAGGGGACATCTGTGCTGGAAATGGTTGCAGCATTCGAGAAAGCTTCTG
GAAAGAAAATCCCGCTTGTATTTGCTGGACGAAGGCCTGGAGATGCCGAGATCGTTTACG
CTCAAACTGCCAAAGCTGAGAAGGAACTGAAATGGAAGGCAAAATACGGGGTAGAGGAGA
TGTGCAGGGACCTGTGGAATTGGGCGAGCAAGAACCCCTACGGGTATGGATCGCCGGACA
GTAGCAACTGATCCAGCTGAATATAGGCGTCCAATCCTCCAGTAGCAGCAGCAGCAGCAT
GACTTCTATACATATATATATATAATCATAAAGAATGAAGAAACAAAGAATTCGGACTTG
TTGAGTTACTACTACTACTACTACTAATCCCATCTGATGGACCGCATTGTATAGGGGGCT
TGTAGGGGTCCAGCAGCTTCATCATC

CDS

1065 bp

>Os05t0595100-01 Uridine-diphospho-(UDP)-glucose 4-epimerase, Cell wall carbohydrate partitioning during nitrogen (N) limitation
ATGGTTTCGGCCTTGTTGCGGACGATCCTGGTGACGGGCGGCGCCGGCTACATCGGCAGC
CACACCGTCCTCCAGCTTCTCCAACTCGGCTTCCGCGTTGTCGTCCTCGACAACCTCGAC
AACGCCTCCGAGCTCGCCATCCTCCGCGTCAGGGAACTCGCCGGACACAACGCCAACAAC
CTCGACTTCCGCAAGGTTGACCTCCGCGACAAGCAAGCGTTGGACCAAATCTTCTCCTCT
CAAAGGTTTGAGGCTGTCATCCATTTTGCCGGGCTGAAAGCTGTTGGCGAGAGCGTGCAG
AAGCCCCTGCTTTACTACGACAACAACCTCATCGGCACCATCACTCTCCTGCAGGTCATG
GCCGCACATGGCTGCACCAAGCTGGTGTTCTCATCATCCGCAACTGTCTACGGGTGGCCC
AAGGAGGTGCCCTGCACTGAAGAATCCCCACTTTGTGCAATGAACCCCTACGGCAGAACA
AAGCTGGTAATCGAAGACATGTGCCGGGATCTGCATGCCTCAGACCCAAACTGGAAGATC
ATACTGCTCCGATACTTCAACCCTGTTGGAGCTCACCCAAGCGGGTACATTGGTGAGGAC
CCCTGCGGCATCCCAAACAACCTCATGCCCTTCGTCCAGCAGGTCGCTGTTGGCAGGAGG
CCGGCCCTTACCGTCTATGGAACCGACTACAACACCAAGGATGGAACTGGGGTTCGTGAC
TATATCCATGTTGTTGATCTAGCGGATGGTCATATCGCCGCGTTAAGGAAGCTCTATGAA
GATTCTGATAGAATAGGATGTGAGGTGTACAATCTGGGCACTGGAAAGGGGACATCTGTG
CTGGAAATGGTTGCAGCATTCGAGAAAGCTTCTGGAAAGAAAATCCCGCTTGTATTTGCT
GGACGAAGGCCTGGAGATGCCGAGATCGTTTACGCTCAAACTGCCAAAGCTGAGAAGGAA
CTGAAATGGAAGGCAAAATACGGGGTAGAGGAGATGTGCAGGGACCTGTGGAATTGGGCG
AGCAAGAACCCCTACGGGTATGGATCGCCGGACAGTAGCAACTGA

Protein

355 aa

>Os05t0595100-01 Uridine-diphospho-(UDP)-glucose 4-epimerase, Cell wall carbohydrate partitioning during nitrogen (N) limitation
MVSALLRTILVTGGAGYIGSHTVLQLLQLGFRVVVLDNLDNASELAILRVRELAGHNANN
LDFRKVDLRDKQALDQIFSSQRFEAVIHFAGLKAVGESVQKPLLYYDNNLIGTITLLQVM
AAHGCTKLVFSSSATVYGWPKEVPCTEESPLCAMNPYGRTKLVIEDMCRDLHASDPNWKI
ILLRYFNPVGAHPSGYIGEDPCGIPNNLMPFVQQVAVGRRPALTVYGTDYNTKDGTGVRD
YIHVVDLADGHIAALRKLYEDSDRIGCEVYNLGTGKGTSVLEMVAAFEKASGKKIPLVFA
GRRPGDAEIVYAQTAKAEKELKWKAKYGVEEMCRDLWNWASKNPYGYGSPDSSN*

5'UTR

chr05:29632006..29632091 (+ strand) : 86 bp

CDS

chr05:29632092..29632286 (+ strand) : 195 bp

chr05:29633017..29633066 (+ strand) : 50 bp

chr05:29633620..29633755 (+ strand) : 136 bp

chr05:29634256..29634357 (+ strand) : 102 bp

chr05:29634478..29634705 (+ strand) : 228 bp

chr05:29634785..29634869 (+ strand) : 85 bp

chr05:29634973..29635055 (+ strand) : 83 bp

chr05:29635179..29635270 (+ strand) : 92 bp

chr05:29635373..29635466 (+ strand) : 94 bp

3'UTR

chr05:29635467..29635661 (+ strand) : 195 bp

FASTA

>Os05t0595100-01 class=Sequence position=chr05:29632006..29635661 (+ strand)
CTTCCGCTCT CTAGCTTTGC TTTGCTTGCT TCATCAAACC CCACACACGC ACACAACAAC AACAAGAGTA ATCAAAGTAG
AAGAAGATGG TTTCGGCCTT GTTGCGGACG ATCCTGGTGA CGGGCGGCGC CGGCTACATC GGCAGCCACA CCGTCCTCCA
GCTTCTCCAA CTCGGCTTCC GCGTTGTCGT CCTCGACAAC CTCGACAACG CCTCCGAGCT CGCCATCCTC CGCGTCAGGG
AACTCGCCGG ACACAACGCC AACAACCTCG ACTTCCGCAA GGTCTTCCTT CCTTCCTTCC TTCCTTACTT AATTCTCTCT
CTCTCTCTCT CTACATTAGA TTCTGATTTT GCGGTTCCTT TTATTAATTT AACAAAACAA AACAACCATT CCCATCTCGA
TAAGCGGCGC GCGGCGATAT ATCATAACTT GTCTTTTTGA TTAGATTGAA ATGAAATCAA TTGGATTGGA TTAATCATCT
CATCTAGTCA ACATATTACT AGTTACTTAT ATCTGTATTC GGGCGACACA AATCCAAATA GTAACTACTC CTCTTCCTCC
TTAGTAATGG AAAGTTAGAG TTCCTACAAA TATTTTTGTT TGAATTGGAG TTGTAGTCGT TCGTTTTCAT GGGGAGGCGG
TCAATTGAAT TGAATTGAAT TGAGTTGGTG GAGTAGTAGT GGAAATGGGA AAAAAAAACC CAAGGAGGGA GGGAGGGAGG
CGTTGGAAGG CGCCGGACGC GTTGTTCCCG CCCCCCTGCT TCATTTCTGT TTTGATTTTT CATGGCCAAG CACACAACGC
ATGCACCACC CACCCCACAT ACGTTCCTTC TACTTTCTTT CCACCCATAT ATAAAAAGAT CCTTTACAAT CCACATCTCA
ATCTCAAATA TAAATAGGAT TATTAATACT AATAAGCTCA TTCCCCTGGT GCATTGCATA CTCATAAAAT TTCTTGCTTA
AAGGACTCAA AATCTATCTT AGACTAATAT AACATATAAA TTATTATGCA GGTTGACCTC CGCGACAAGC AAGCGTTGGA
CCAAATCTTC TCCTCTCAAA GGTTGGTTAG TCTTCCTTGC TCCTTCAATT TGCACTTAAG TACCTACCTT TAATTTGTTT
TCATTTTTGG TTAGCAGCGT GACACCGTAA ATTTCAGCAT AATATATATA CAAACTATAG CTATTAAACT ATTTCAGCAT
AATTTCATCG GTCGGTCGGT CGGTCGGTCG TTTATTCCAT GAATCAAATC AAATCGATCA TTGTCAAAAT AATTACTCCT
CATCATGTAT TACAAGTATT CTGGACCTAG CTAGCTGCTC AGCCAGCCTG CCAGGTCAAG AATCTGGTGC TTGGCCAGTT
TAATTTGCAG CCGTCTATCA CGCACGGTAG CTGTCACGCT CATAGTACCA ACCAACGAAC CGAACCTTCC TTGTGGAATT
AATGCATTAC TATATATCAC AGGTGACAGT CCATCCCTTT TGTACCCAAC CGCGTAGTAT ACTGGAGTAC TAATAAGCAA
TACTATGATG AATGAAATGA AGAGTAGTAG TAGGTATTAT TATCTGTTTT GGCGAAGATT TGAGACGGAC GGACGCTGGT
CTGCTTGGCT GCAGGTTTGA GGCTGTCATC CATTTTGCCG GGCTGAAAGC TGTTGGCGAG AGCGTGCAGA AGCCCCTGCT
TTACTACGAC AACAACCTCA TCGGCACCAT CACTCTCCTG CAGGTCATGG CCGCACATGG CTGCACCAAG GTACAGCCCC
CGCACCATTT CATTTATTTT TCTCCCATTG TTTTGCTTTG CCTATATGTA TATGCGTGCC TCTTGCTGGC TTTATTGGTT
GGCTGGCCTG GCTCTTCTTT GCATTGCTGG GGGTCACAGG ATATACCTTA TGCCTTTTTG CATTGCTGGG GAACACAGGA
ACATATACCA CAGATTACCT ACCTATCACA ACCACTCTGT GTCTGTGTGT GTTGTTTGCC ATGCATGATG CACGGGAATA
TAACCCTCCC CTCTTAAAAT TGCTGCCTGC CTGGTCCCAC TCCCAGCCAA GATTTTTTTT TTTGTTCTCT TCCTACTGCC
CTCTGATTTT TCTTCTTCCT TTCATCTTGT TTTGGTTGGT TGGTTGGTTC TGAGCTTACT CTGGAGGCGG CATCGCAACA
GATTTATACT TACTTAATCC ACTAAAAGTA AACATATATG CTTTAGTTTT TAATAATGGA CATAATCATA AGCTATTTTG
CTCCGGCCAG CTGGTGTTCT CATCATCCGC AACTGTCTAC GGGTGGCCCA AGGAGGTGCC CTGCACTGAA GAATCCCCAC
TTTGTGCAAT GAACCCCTAC GGCAGAACAA AGGTACTCCA GTTTTTTCTC TTCTGTTATA CTATATTCAG TTCAATCATC
ATGCCTAGGA TCAATCAATC AATAAATCCT AATTAAGCCA AACAACATAT ATATGATATG ATATGATTGC AGCTGGTAAT
CGAAGACATG TGCCGGGATC TGCATGCCTC AGACCCAAAC TGGAAGATCA TACTGCTCCG ATACTTCAAC CCTGTTGGAG
CTCACCCAAG CGGGTACATT GGTGAGGACC CCTGCGGCAT CCCAAACAAC CTCATGCCCT TCGTCCAGCA GGTCGCTGTT
GGCAGGAGGC CGGCCCTTAC CGTCTATGGA ACCGACTACA ACACCAAGGA TGGAACTGGG GTATGTATAT GCATTATTCA
TTCATTCTCA ACAATCAGTC GTATATGATT TACTAATTAA TTTTATTCCT TGCCGGCAGG TTCGTGACTA TATCCATGTT
GTTGATCTAG CGGATGGTCA TATCGCCGCG TTAAGGAAGC TCTATGAAGA TTCTGATAGA ATAGGTATAT ATGAACCCTC
TCTTGTTGTG CATCCATCCA CGGGACGGGA CACATGAAAA CATCATCATC TCATAAATTA ATAATTTATG TGGCTATATT
CTTCCAGGAT GTGAGGTGTA CAATCTGGGC ACTGGAAAGG GGACATCTGT GCTGGAAATG GTTGCAGCAT TCGAGAAAGC
TTCTGGAAAG GTAAACTAAC AGGACAAGTG TACTTCCTCT TAATTACTAT AATAATCATT AATTCCCAAC TTGTCCTTTG
CTTTTGTTGA TCATATGATG TCGTCCTAAC AATAATAATG CCAACTTGAA CAGAAAATCC CGCTTGTATT TGCTGGACGA
AGGCCTGGAG ATGCCGAGAT CGTTTACGCT CAAACTGCCA AAGCTGAGAA GGAACTGAAA TGGAAGTAAG TATCAGGATA
TATATATATA TATAGCATCT CACATCATTT CATCTGTACT GTAATGAAAT GAAATATTAA AATCATCATG TACTCTCTTC
ACACCAGGGC AAAATACGGG GTAGAGGAGA TGTGCAGGGA CCTGTGGAAT TGGGCGAGCA AGAACCCCTA CGGGTATGGA
TCGCCGGACA GTAGCAACTG ATCCAGCTGA ATATAGGCGT CCAATCCTCC AGTAGCAGCA GCAGCAGCAT GACTTCTATA
CATATATATA TATAATCATA AAGAATGAAG AAACAAAGAA TTCGGACTTG TTGAGTTACT ACTACTACTA CTACTAATCC
CATCTGATGG ACCGCATTGT ATAGGGGGCT TGTAGGGGTC CAGCAGCTTC ATCATC

Locus: Os05g0595100

Loading...

Locus: Os05g0595100

Loading...