Os06t0101800-01

Locus

Os06g0101800

Description

Similar to NAC-domain protein 1-1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC19

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 19

Oryzabase Gene Symbol Synonym(s)

ONAC019, ONAC19

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 019, NAC domain-containing protein 19

Transcript Evidence

AK064178 (DDBJ, Best hit)

Protein Evidence

B9FR17 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

002-104-B01 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0101800-01)

RiceXPro (AK064178)

Others

Oryzabase (11468)

KEGG (Os06t0101800-01)

Transcript

2281 bp

>Os06t0101800-01 Similar to NAC-domain protein 1-1.
ATATAAAGTGGTTCTCAAAAAAAAAGTGAAAGACAGAGAGGTCGGAGAAGGGAAAAGTGG
CGATGAAACAAGGGAAAGTGGAGATGACGCCGGCGGTCGCCGCCGCGGCGGTTCtgccgg
tggggttccgtttccggccgacggacgaggagctggtgaggcactatctgaagggaaaga
tcgctgggcggagccaccctgacctcctcctcatcccggacgtggacctctccacctgcg
agccctgggatctcccggCCATGTCCGTTATCAAGTCCGACGACCCCgagtggttcttct
tcgccccccgcgaccgcaagtatcccggcggccaccgctccaaccgctccaccgccgccg
gctactggaaggccaccggcaaggaccgcctcatccgctcccgccccgccggccccctca
tcggcatcaagaagaccctcgtcttccaccgcggcagagctccgcggggcctccgcaccg
cctggatcatgcacgagtaccgcaccactgagcctcacttccaatcaggcaaaaacGGTA
GCTTCGTTCTGTATCGCCTGTTTAACAAGCACGAACAAGATGATACCCATACCCCGGCCT
CCAATTTGGACCAACAATTGTCCACGTCTTCTCAAGGCAATCCCCAAAATGGCACACCTG
CTGTCCAACCGGCCCTCGCCTCAATAATGAAGGATCATCAGACCTTACCATCATCTGGTT
TCAGCCAACTGACTGAAATACAAGATGCTAGTACATCTGTCCATGACAAAGAGCAAACTG
TAGCCCATGACGATGCTTTTCTGGACGTGTTATCTCAACTTCCAGACCTAGAGCCTGAGC
AAAGATACAATGGATTCCCTAATATCACCTCTCCAATTCGCCCTTACAGCGATCACCCTT
TTGTCGGCAATCTGGGTGAGCAAGATCTTTCAGCGCATTTTGGCAGTACCTTGTCTGAGC
AGGACCTGCAAAGTTTGTTGTTTAGTCCAAATTACACCAAAATGGATAAGCACCCCACTG
GAAACGTAGAGTCTAATCCTACCGCGTCGTCCAACAATCCAAACAATAACACATTACTCA
TGGATAGTTGGAGGAAGAATGATTCATATCAGATGCTTCTAATTCAGGTTAGAATATTCT
AGAATTTACTCTTACACATTTTGACTAATCTCATGAGAACATTTTCTTCCCTTCTATTTC
CTGTTCTAAACAAAGCGTGCAGACAACACAGATGCTACTTGCTGTTCTTCTTCAATCAAT
GCACCACAAACAGAAACAAGTGATGCTAATCTTGAAGCAAGAGCCCAGAGTAGCAGCATG
GTCTACAGTGGAGTAGCCGAGGGCTCCCCCTTGTGCAACCAAGATCAACTACACTCCGCA
TTCAATCCTCACATGGAGTCACAAAAGAGTGGAGCCTTCTGTTGGGCTGGATTGTGGACC
CCTTATCCCCAGCATTGGTTCGATACTATCGTAGAACCGGGCAGGAGTGGCATGACATTT
TCAGATGCCTTGAAAGAACAAGGTCAGGAACAGGCACCTTCAATGAAGCACTTGACAGCT
CAAGATCTCGTTGATCCACAACAAGGAACTGCTGCAAGAAGGATCCGCCTTGTATGCTCT
GTTGAGAGGGCATCAGTCTCTCAACCTGTATCCTCACATTTGCAGAGTGAATATGAAGCT
GGATCATGCTGTAACACTCGCAATTCATCTAATAACAAGAAGGAAAGTGTCAGGAGTGAA
GATGAAGCTGGATCATGTTGTAACACTGGAAGTTCATCTAATAACCACAGCGAGGAAAAT
GACGATGCAGCCTCCCAGATTATGGATGGAGAACCAATGCATATTCAGTGCAAAGAGGAT
ACCCCTATTCAAGTGGATCATTCAGTGGAAGTTATGGACAAGCTCCAAGGCTTCTCCTTT
CATGAAGAGATGTTGGTACATGCTAATCAGCCCCGTGGAACTAATCTAAAGCAGAGGCTG
TTGAGAGTGGAGTCTAGAAATAGCAATGAGAATAATGTACCTTCGTTGGAGACACGAGAA
CAGCAGCATGCACCTCATATTCAGAAATGGACTAGCTCTGTTGTGCGACTAGGGTGGGGG
TGGCAGTGGCCGGCTCTCTTTGTGATGGCCGGCTCTCTGCTTTTGTTGGTTGGTGTGTGG
AAATCTCTGAATCACACTACCTGACTAATGTAAATAAATGGTCGCTTAGCTTAAGCTTGG
GAGCCTCATATATACTACTACATATGTTCTTTGGAAAGTACTGCAGGTAACTGGTTCATA
T

CDS

1080 bp

>Os06t0101800-01 Similar to NAC-domain protein 1-1.
ATGAAACAAGGGAAAGTGGAGATGACGCCGGCGGTCGCCGCCGCGGCGGTTCtgccggtg
gggttccgtttccggccgacggacgaggagctggtgaggcactatctgaagggaaagatc
gctgggcggagccaccctgacctcctcctcatcccggacgtggacctctccacctgcgag
ccctgggatctcccggCCATGTCCGTTATCAAGTCCGACGACCCCgagtggttcttcttc
gccccccgcgaccgcaagtatcccggcggccaccgctccaaccgctccaccgccgccggc
tactggaaggccaccggcaaggaccgcctcatccgctcccgccccgccggccccctcatc
ggcatcaagaagaccctcgtcttccaccgcggcagagctccgcggggcctccgcaccgcc
tggatcatgcacgagtaccgcaccactgagcctcacttccaatcaggcaaaaacGGTAGC
TTCGTTCTGTATCGCCTGTTTAACAAGCACGAACAAGATGATACCCATACCCCGGCCTCC
AATTTGGACCAACAATTGTCCACGTCTTCTCAAGGCAATCCCCAAAATGGCACACCTGCT
GTCCAACCGGCCCTCGCCTCAATAATGAAGGATCATCAGACCTTACCATCATCTGGTTTC
AGCCAACTGACTGAAATACAAGATGCTAGTACATCTGTCCATGACAAAGAGCAAACTGTA
GCCCATGACGATGCTTTTCTGGACGTGTTATCTCAACTTCCAGACCTAGAGCCTGAGCAA
AGATACAATGGATTCCCTAATATCACCTCTCCAATTCGCCCTTACAGCGATCACCCTTTT
GTCGGCAATCTGGGTGAGCAAGATCTTTCAGCGCATTTTGGCAGTACCTTGTCTGAGCAG
GACCTGCAAAGTTTGTTGTTTAGTCCAAATTACACCAAAATGGATAAGCACCCCACTGGA
AACGTAGAGTCTAATCCTACCGCGTCGTCCAACAATCCAAACAATAACACATTACTCATG
GATAGTTGGAGGAAGAATGATTCATATCAGATGCTTCTAATTCAGGTTAGAATATTCTAG

Protein

360 aa

>Os06t0101800-01 Similar to NAC-domain protein 1-1.
MKQGKVEMTPAVAAAAVLPVGFRFRPTDEELVRHYLKGKIAGRSHPDLLLIPDVDLSTCE
PWDLPAMSVIKSDDPEWFFFAPRDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRPAGPLI
GIKKTLVFHRGRAPRGLRTAWIMHEYRTTEPHFQSGKNGSFVLYRLFNKHEQDDTHTPAS
NLDQQLSTSSQGNPQNGTPAVQPALASIMKDHQTLPSSGFSQLTEIQDASTSVHDKEQTV
AHDDAFLDVLSQLPDLEPEQRYNGFPNITSPIRPYSDHPFVGNLGEQDLSAHFGSTLSEQ
DLQSLLFSPNYTKMDKHPTGNVESNPTASSNNPNNNTLLMDSWRKNDSYQMLLIQVRIF*

5'UTR

chr06:156557..156618 (- strand) : 62 bp

CDS

chr06:156083..156556 (- strand) : 474 bp

chr06:155740..155991 (- strand) : 252 bp

chr06:155285..155638 (- strand) : 354 bp

3'UTR

chr06:154603..155284 (- strand) : 682 bp

chr06:154432..154531 (- strand) : 100 bp

chr06:153418..153774 (- strand) : 357 bp

FASTA

>Os06t0101800-01 class=Sequence position=chr06:153418..156618 (- strand)
ATATAAAGTG GTTCTCAAAA AAAAAGTGAA AGACAGAGAG GTCGGAGAAG GGAAAAGTGG CGATGAAACA AGGGAAAGTG
GAGATGACGC CGGCGGTCGC CGCCGCGGCG GTTCtgccgg tggggttccg tttccggccg acggacgagg agctggtgag
gcactatctg aagggaaaga tcgctgggcg gagccaccct gacctcctcc tcatcccgga cgtggacctc tccacctgcg
agccctggga tctcccggCC ATGTCCGTTA TCAAGTCCGA CGACCCCgag tggttcttct tcgccccccg cgaccgcaag
tatcccggcg gccaccgctc caaccgctcc accgccgccg gctactggaa ggccaccggc aaggaccgcc tcatccgctc
ccgccccgcc ggccccctca tcggcatcaa gaagaccctc gtcttccacc gcggcagagc tccgcggggc ctccgcaccg
cctggatcat gcacgagtac cgcaccactg agcctcactt ccaatcaggc aaaaacgtaa gcacgACCAA ATATATACTG
TCTACTCCAT ACTCTAAATA TAAATAGCTG AGCAAATCAA ATGTGTCTAT TTGCTTTAAT TTGTCAGGGT AGCTTCGTTC
TGTATCGCCT GTTTAACAAG CACGAACAAG ATGATACCCA TACCCCGGCC TCCAATTTGG ACCAACAATT GTCCACGTCT
TCTCAAGGCA ATCCCCAAAA TGGCACACCT GCTGTCCAAC CGGCCCTCGC CTCAATAATG AAGGATCATC AGACCTTACC
ATCATCTGGT TTCAGCCAAC TGACTGAAAT ACAAGATGCT AGTACATCTG TCCATGACAA AGAGCAAACT GTAGCCCATG
TGAGTTTCTT ATTAATTCTC CTGCATTACT GGTCCCCATG GCATTTATAT GATAATAAAT TTCTTTTCTT TTTTTTCTTT
TGTGTGTGTG TAAAACTTAG GACGATGCTT TTCTGGACGT GTTATCTCAA CTTCCAGACC TAGAGCCTGA GCAAAGATAC
AATGGATTCC CTAATATCAC CTCTCCAATT CGCCCTTACA GCGATCACCC TTTTGTCGGC AATCTGGGTG AGCAAGATCT
TTCAGCGCAT TTTGGCAGTA CCTTGTCTGA GCAGGACCTG CAAAGTTTGT TGTTTAGTCC AAATTACACC AAAATGGATA
AGCACCCCAC TGGAAACGTA GAGTCTAATC CTACCGCGTC GTCCAACAAT CCAAACAATA ACACATTACT CATGGATAGT
TGGAGGAAGA ATGATTCATA TCAGATGCTT CTAATTCAGG TTAGAATATT CTAGAATTTA CTCTTACACA TTTTGACTAA
TCTCATGAGA ACATTTTCTT CCCTTCTATT TCCTGTTCTA AACAAAGCGT GCAGACAACA CAGATGCTAC TTGCTGTTCT
TCTTCAATCA ATGCACCACA AACAGAAACA AGTGATGCTA ATCTTGAAGC AAGAGCCCAG AGTAGCAGCA TGGTCTACAG
TGGAGTAGCC GAGGGCTCCC CCTTGTGCAA CCAAGATCAA CTACACTCCG CATTCAATCC TCACATGGAG TCACAAAAGA
GTGGAGCCTT CTGTTGGGCT GGATTGTGGA CCCCTTATCC CCAGCATTGG TTCGATACTA TCGTAGAACC GGGCAGGAGT
GGCATGACAT TTTCAGATGC CTTGAAAGAA CAAGGTCAGG AACAGGCACC TTCAATGAAG CACTTGACAG CTCAAGATCT
CGTTGATCCA CAACAAGGAA CTGCTGCAAG AAGGATCCGC CTTGTATGCT CTGTTGAGAG GGCATCAGTC TCTCAACCTG
TATCCTCACA TTTGCAGAGT GAATATGAAG CTGGATCATG CTGTAACACT CGCAATTCAT CTAATAACAA GAAGGAAAGT
GTCAGGAGTG AAGATGAAGC TGGATCATGT TGTAACACTG GAAGTTCATC TAATAACCAC AGCGAGGAAA ATGACGATGC
AGCCTCCCAG ATTATGGTAC TACTACAGTT TATTGTAAGT CTATTTACTC ATAGTAGTAT AGTTTTGATT AAAATGGTCT
TGATCAGGAT GGAGAACCAA TGCATATTCA GTGCAAAGAG GATACCCCTA TTCAAGTGGA TCATTCAGTG GAAGTTATGG
ACAAGCTCCA AGGCTTCTCC TTTCATGGTA AGCAATCTTT GTTAAATTCG TAATTAGAAC TTGAGACATT GAAATTTATA
TCTTCCACCT GGCAAAAAGA AATTTATATC TTCCTACATA TACCTCATGA AGGGTCCTGG ACTTTTTCTT TCTTGCTAGT
GTAAAGTGGT AGTCATCGTT AATAAATATT AGTGGTGTAT TTACCAAGCT AGCAAGGGTA TGACATGCAT TCGCCCCTAG
ATCTCAAGTA CAATTAGCTA ATTTGAAAAA GGTCAATATT GGCTTGAGAT GTCATTAATG CTAAGTGTAA GAACTTGAGT
TTTCTATATA TTGAAAAAAT ATATAGtact ccctccgttc cacattatag gatgttttgg cctctccatc gctcttctag
attcactact attcatatga atttgaacat atatatgtaa cacatacatc gacctatgca tgaacctatt caaaacccaa
aacgtcttat aatgtgaaaG TATGGGATTT TGTCCACGAA CAGTAGGTCT TCGTCTCTTA TGCGGTATAG TTTAGAGGAT
GGGATCGTGT GGAACATTTG TGAAACAGAC TACTGGAGCC AATGTTGTTT GCAGGGCTGT TGTGGCTGAG TTATTTTTTT
CTCTCTGACG ATGTAGCTGA TCTCCTTCAA TTTCCCACGT GCAGAAGAGA TGTTGGTACA TGCTAATCAG CCCCGTGGAA
CTAATCTAAA GCAGAGGCTG TTGAGAGTGG AGTCTAGAAA TAGCAATGAG AATAATGTAC CTTCGTTGGA GACACGAGAA
CAGCAGCATG CACCTCATAT TCAGAAATGG ACTAGCTCTG TTGTGCGACT AGGGTGGGGG TGGCAGTGGC CGGCTCTCTT
TGTGATGGCC GGCTCTCTGC TTTTGTTGGT TGGTGTGTGG AAATCTCTGA ATCACACTAC CTGACTAATG TAAATAAATG
GTCGCTTAGC TTAAGCTTGG GAGCCTCATA TATACTACTA CATATGTTCT TTGGAAAGTA CTGCAGGTAA CTGGTTCATA
T

Locus: Os06g0101800

Loading...

Locus: Os06g0101800

Loading...