Os06t0103000-01

Locus

Os06g0103000

Description

CCT domain containing protein, Regulation of heading date

RAP-DB Gene Symbol Synonym(s)

OsCCT19

RAP-DB Gene Name Synonym(s)

CCT domain-containing gene 19

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBBX15, OsCCT19, OsS, OsSTA162, BBX15, CCT19, STA162

Oryzabase Gene Name Synonym(s)

B-box-containing protein 15, CCT domain-containing gene 19, CCT (CO, CO-LIKE and TOC1) domain protein 19, CCT domain protein 19

Transcript Evidence

XM_015786699

Protein Evidence

Q5VRH5

Literature

PMID: 25563494

Note

Manual Curation

January 28, 2021

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

B-box-type zinc finger (IPR000315)

CCT domain (IPR010402)

Expression Databases

TENOR (Os06t0103000-00)

Others

Oryzabase (11646)

Transcript

699 bp

>Os06t0103000-01 CCT domain containing protein, Regulation of heading date
ATGGAAAATGAGGTGGGTTGCGAGTGCCAGCTGTGCGGTGGGCGGCGTGGCGTGGTGTTC
TGCGGCGCCCACGGCGGGCGCCTCTGCCTCCAATGCGACCGAGCCCTGCACCAAGCCCAC
GGCGGGGCCGGCGATCACCCCCGCGCGCCGCTCTGCGACTCGTGCAACGCCGCCGCCGCC
GAGCTGCGCCTCAACGACGGGGCCACGCTGTGCGGGCCGTGCGCCTACCCCTACGCCTAC
GCCTACCCCTACACATACACCTACGTCTACACCGGCTGCCCCACCCCGCTGGAGATGATG
CGCCTCCTCCATGCCGCCCCGCCGCCGCCGCCAGCTACCTGCAGTTTACAACAACGAGGA
GAAGGAGAAGAGCTACTTCCAACTCTCTTATCTGCGACTGCGACTCCTAATACTGCTACT
GCTGCGCCAATGGCAATGCCACCCCCACCACTACAACACCACACCACCACCTCCCTCATC
ATGATGATAAGGAACATTCACAAGCGGGAGGAGAGGAACAGAGCCAAGCTCAGGTACAAT
GATAAGAAGAAGACGAGGAAGTTCAGCAAGCAGATCAAGTATGCCTGCCGCAAGGCCGGA
GCCGACGCACGAAAGCGGGTCAAAGGCCGATTCGCAAAGGCCTCTTCCTCCTCCTCCTCC
TCCTCCTCCTCTTCTTCTTCCATCGATCATCGATTATGA

CDS

699 bp

>Os06t0103000-01 CCT domain containing protein, Regulation of heading date
ATGGAAAATGAGGTGGGTTGCGAGTGCCAGCTGTGCGGTGGGCGGCGTGGCGTGGTGTTC
TGCGGCGCCCACGGCGGGCGCCTCTGCCTCCAATGCGACCGAGCCCTGCACCAAGCCCAC
GGCGGGGCCGGCGATCACCCCCGCGCGCCGCTCTGCGACTCGTGCAACGCCGCCGCCGCC
GAGCTGCGCCTCAACGACGGGGCCACGCTGTGCGGGCCGTGCGCCTACCCCTACGCCTAC
GCCTACCCCTACACATACACCTACGTCTACACCGGCTGCCCCACCCCGCTGGAGATGATG
CGCCTCCTCCATGCCGCCCCGCCGCCGCCGCCAGCTACCTGCAGTTTACAACAACGAGGA
GAAGGAGAAGAGCTACTTCCAACTCTCTTATCTGCGACTGCGACTCCTAATACTGCTACT
GCTGCGCCAATGGCAATGCCACCCCCACCACTACAACACCACACCACCACCTCCCTCATC
ATGATGATAAGGAACATTCACAAGCGGGAGGAGAGGAACAGAGCCAAGCTCAGGTACAAT
GATAAGAAGAAGACGAGGAAGTTCAGCAAGCAGATCAAGTATGCCTGCCGCAAGGCCGGA
GCCGACGCACGAAAGCGGGTCAAAGGCCGATTCGCAAAGGCCTCTTCCTCCTCCTCCTCC
TCCTCCTCCTCTTCTTCTTCCATCGATCATCGATTATGA

Protein

233 aa

>Os06t0103000-01 CCT domain containing protein, Regulation of heading date
MENEVGCECQLCGGRRGVVFCGAHGGRLCLQCDRALHQAHGGAGDHPRAPLCDSCNAAAA
ELRLNDGATLCGPCAYPYAYAYPYTYTYVYTGCPTPLEMMRLLHAAPPPPPATCSLQQRG
EGEELLPTLLSATATPNTATAAPMAMPPPPLQHHTTTSLIMMIRNIHKREERNRAKLRYN
DKKKTRKFSKQIKYACRKAGADARKRVKGRFAKASSSSSSSSSSSSSIDHRL*

CDS

chr06:209204..209533 (+ strand) : 330 bp

chr06:209642..209871 (+ strand) : 230 bp

chr06:209969..210107 (+ strand) : 139 bp

FASTA

>Os06t0103000-01 class=Sequence position=chr06:209204..210107 (+ strand)
ATGGAAAATG AGGTGGGTTG CGAGTGCCAG CTGTGCGGTG GGCGGCGTGG CGTGGTGTTC TGCGGCGCCC ACGGCGGGCG
CCTCTGCCTC CAATGCGACC GAGCCCTGCA CCAAGCCCAC GGCGGGGCCG GCGATCACCC CCGCGCGCCG CTCTGCGACT
CGTGCAACGC CGCCGCCGCC GAGCTGCGCC TCAACGACGG GGCCACGCTG TGCGGGCCGT GCGCCTACCC CTACGCCTAC
GCCTACCCCT ACACATACAC CTACGTCTAC ACCGGCTGCC CCACCCCGCT GGAGATGATG CGCCTCCTCC ATGCCGCCCC
GCCGCCGCCG GTATTCAGTC ACCCTCATCT CTTCTCTCAT CTGAATTTGG CTCTATAGTT TCCTGCAGTC GGCAGGTCCA
GGAAACCCGA TGCTGGTACA ATAATGCATC ATATGCAGCC AGCTACCTGC AGTTTACAAC AACGAGGAGA AGGAGAAGAG
CTACTTCCAA CTCTCTTATC TGCGACTGCG ACTCCTAATA CTGCTACTGC TGCGCCAATG GCAATGCCAC CCCCACCACT
ACAACACCAC ACCACCACCT CCCTCATCAT GATGATAAGG AACATTCACA AGCGGGAGGA GAGGAACAGA GCCAAGCTCA
GGTACAATGA TAAGAAGAAG ACGAGGAAGT ACGTATATAT ATACTCTACT TATTACTACT TGCAAGTGCA ACAACCCCCA
AATGATCTCA TCTTAACATA AGCTAATTAA ATTAAATTGA TGCAGGTTCA GCAAGCAGAT CAAGTATGCC TGCCGCAAGG
CCGGAGCCGA CGCACGAAAG CGGGTCAAAG GCCGATTCGC AAAGGCCTCT TCCTCCTCCT CCTCCTCCTC CTCCTCTTCT
TCTTCCATCG ATCATCGATT ATGA

Locus: Os06g0103000

Loading...

Locus: Os06g0103000

Loading...